BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_L14 (551 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_02_0012 - 7346282-7347136,7347234-7347593 27 10.0 04_03_0314 - 14238620-14240128 27 10.0 >11_02_0012 - 7346282-7347136,7347234-7347593 Length = 404 Score = 27.1 bits (57), Expect = 10.0 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -2 Query: 505 VVTTSREGR--AATTRCSMD*ACRRLFCREATQAVHFFAFFLGEGALPXALF 356 VV + EG AA T C+M C L A H FAFF+ E LF Sbjct: 342 VVEVNEEGTEAAAATACTMKFLCLTLTSPVDFVADHPFAFFVVEEKSDAVLF 393 >04_03_0314 - 14238620-14240128 Length = 502 Score = 27.1 bits (57), Expect = 10.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 364 LKAKPLHPRRMRRSEPPVS 420 L +P+HPRR+R PP S Sbjct: 14 LSPQPIHPRRVRLPNPPPS 32 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,581,456 Number of Sequences: 37544 Number of extensions: 167493 Number of successful extensions: 555 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1245816180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -