BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_L13 (524 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40200.1 68418.m04878 DegP protease, putative contains simila... 29 2.5 At5g27230.1 68418.m03248 expressed protein ; expression support... 28 4.4 At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to... 28 4.4 At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase fa... 28 4.4 At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CH... 27 5.8 At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CH... 27 5.8 At5g34900.1 68418.m04114 Ulp1 protease family protein contains P... 27 5.8 At4g22320.1 68417.m03227 expressed protein 27 5.8 At5g52920.1 68418.m06567 pyruvate kinase, putative similar to py... 27 7.7 At3g57300.1 68416.m06378 transcriptional activator, putative sim... 27 7.7 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 156 NVDDEYYKIGKDYDVEANIDXYTNKKAVEEFLKLYRI 266 N +DEY K DYD +D T K+A + L + I Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCI 578 >At5g27230.1 68418.m03248 expressed protein ; expression supported by MPSS Length = 948 Score = 27.9 bits (59), Expect = 4.4 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +3 Query: 90 VDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDXYTNKKAVEEFLK 254 V A+ +E+++K L L + + E+ K KD+D+E + K+ VE+ K Sbjct: 69 VKALELEKKEKELCLIDESMKAK-QSEFEKKEKDFDLEQKAEVEKRKREVEQLEK 122 >At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula] Length = 365 Score = 27.9 bits (59), Expect = 4.4 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +3 Query: 33 ALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIG 185 ++V S VV Y F V + E +KK+ F + DQ DDE YK G Sbjct: 306 SVVGSGVVIFGLYIFLLGKVRLMKEECEKKLPCRFNEDDQEEDDDEQYKKG 356 >At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Homo sapiens [SP|Q9Y2Q0, SP|O43520]; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1228 Score = 27.9 bits (59), Expect = 4.4 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = -1 Query: 395 SESGTLVEG-FKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQFQ 249 S SG ++E +KV +++E K + + E+G++++L K DS+ F+ Sbjct: 595 SGSGQIIEREYKVLNLLEFTSKRKRMTVIVRDEEGQILLLCKGADSIIFE 644 >At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 742 Score = 27.5 bits (58), Expect = 5.8 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 290 LIVLGKITDSVQFQEFFNSFLIGVVI 213 ++V G ITD++ F +F++GV+I Sbjct: 204 VLVCGFITDAIGIHSMFGAFVVGVLI 229 >At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 810 Score = 27.5 bits (58), Expect = 5.8 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 290 LIVLGKITDSVQFQEFFNSFLIGVVI 213 ++V G ITD++ F +F++GV+I Sbjct: 272 VLVCGFITDAIGIHSMFGAFVVGVLI 297 >At5g34900.1 68418.m04114 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At1g32840, At4g04010, At2g06430, At2g15140, At2g04980, At2g14130, At3g44500, At2g15190, At3g47260, At3g29210, At2g02210, At3g32900 Length = 767 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +3 Query: 120 KVLSLFQDVDQVNVDDEYYKIGKDYDVEANI-DXYTNKKAVEEFLKLYRIGYLPKYYEFS 296 K+++L DV ++ V+ IG D ++ + D +TN ++ L+L ++GY K E++ Sbjct: 287 KIVNLVNDVYEIEVNTI---IGNPEDFKSLVPDFHTNDTEFQQVLELVKMGYRLKKTEWN 343 >At4g22320.1 68417.m03227 expressed protein Length = 238 Score = 27.5 bits (58), Expect = 5.8 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 84 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDXYTNKKAVEE 245 K V +E QKK ++ ++ D++ DD KI +D VE D K VEE Sbjct: 115 KYVPIAVLEEQKKEITEIEEDDKIEEDD---KIDEDNKVEQE-DKVDEDKTVEE 164 >At5g52920.1 68418.m06567 pyruvate kinase, putative similar to pyruvate kinase isozyme G, chloroplast precursor [Nicotiana tabacum] SWISS-PROT:Q40546 Length = 579 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 192 YDVEANIDXYTNKKAVEEFLKLYRIGYLPKYYEFS 296 Y I +TN+K +++ L LY+ G P Y EF+ Sbjct: 496 YRPSGTIYAFTNEKKIQQRLALYQ-GVCPIYMEFT 529 >At3g57300.1 68416.m06378 transcriptional activator, putative similar to transcriptional activator SRCAP [Homo sapiens] GI:5106572; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1507 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 393 ARVHLNEGQFLYAYYIAVIQRNDTHGFV 476 AR L+EG L +Y+ ++++ DT+ V Sbjct: 295 ARTILSEGGVLQVHYVKILEKGDTYEIV 322 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,821,152 Number of Sequences: 28952 Number of extensions: 209747 Number of successful extensions: 535 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 535 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -