BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I10A02NGRL0005_L08
(480 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF109356-1|AAQ13504.1| 249|Homo sapiens MSTP002 protein. 29 6.4
>AF109356-1|AAQ13504.1| 249|Homo sapiens MSTP002 protein.
Length = 249
Score = 29.5 bits (63), Expect = 6.4
Identities = 11/32 (34%), Positives = 15/32 (46%)
Frame = -1
Query: 204 YENKELEWISTFSTSWQHQSIWHAFKTFRHIQ 109
Y N +W+ W Q +WHA T+ H Q
Sbjct: 202 YSNLVYDWVKAGRPLWCCQHLWHASTTWTHPQ 233
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 67,791,657
Number of Sequences: 237096
Number of extensions: 1454177
Number of successful extensions: 6953
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6866
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6953
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 4270724850
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -