BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_L07 (661 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02580.1 68414.m00209 maternal embryogenesis control protein ... 34 0.073 >At1g02580.1 68414.m00209 maternal embryogenesis control protein / MEDEA (MEA) nearly identical to MEDEA GB:AAC39446 GI:3089625 from [Arabidopsis thaliana]; contains Pfam profile PF00856: SET domain Length = 689 Score = 34.3 bits (75), Expect = 0.073 Identities = 26/100 (26%), Positives = 40/100 (40%), Gaps = 3/100 (3%) Frame = +2 Query: 362 EILELKLVRSTEDLEDDDTSFSPEMCHQVFGENENIFGYT---DLHIKLFYSAGSLQTYL 532 E LEL ED E+D+ E C F E+ + F +T D + +L YL Sbjct: 166 EALELSSEEDEEDEEEDEEEIKKEKCE--FSEDVDRFIWTVGQDYGLDDLVVRRALAKYL 223 Query: 533 GIDYTDXIEPFTSEGMKADDIEGALKKVLAPGYVTNLDQF 652 +D +D +E + +K D G + + T F Sbjct: 224 EVDVSDILERYNELKLKNDGTAGEASDLTSKTITTAFQDF 263 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,513,464 Number of Sequences: 28952 Number of extensions: 264828 Number of successful extensions: 496 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -