BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K22 (292 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 0.76 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 1.8 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 23 1.8 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 22 4.1 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 22 5.4 AY341429-1|AAR03495.1| 193|Anopheles gambiae sulfakinin preprop... 22 5.4 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 22 5.4 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 21 7.1 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 21 7.1 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 21 7.1 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 21 7.1 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 21 7.1 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 21 7.1 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 21 9.4 AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 21 9.4 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 21 9.4 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 21 9.4 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 21 9.4 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 21 9.4 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 21 9.4 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 21 9.4 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 21 9.4 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 21 9.4 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 21 9.4 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 21 9.4 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 21 9.4 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 21 9.4 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 21 9.4 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.6 bits (51), Expect = 0.76 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 106 TIVHHVNSVCGSHGQYGEEEKHESFHCRIVSEL 8 +I H + +CG + +EK E+F ++ L Sbjct: 2732 SISHGLEQICGGSADFPSQEKAENFLMHLLMPL 2764 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +2 Query: 146 ANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 256 A+PD F S P + +S ++ P +PP Sbjct: 370 AHPDHFLDHRSPSPQRGNQSLSQMTEILEAIQPEFPP 406 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 23.4 bits (48), Expect = 1.8 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 16 TLFDNESFRVFLLRRIGHGCRKQSS 90 TLFD E F VF + G KQS+ Sbjct: 319 TLFDREGFAVFRDHKSMLGALKQST 343 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 244 GMIEIDERRSSAYGFII 194 G+++ DER +SAY F + Sbjct: 680 GLMDCDERFTSAYQFAV 696 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 230 DFNHPNYPPKRYDXPLARG 286 DF+ P PP R+D + G Sbjct: 399 DFDIPALPPSRFDVAASGG 417 >AY341429-1|AAR03495.1| 193|Anopheles gambiae sulfakinin preproprotein protein. Length = 193 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 244 GMIEIDERRSSAYGFIISART 182 G+ E D+ R S GF+ ART Sbjct: 118 GVDEQDQMRFSLEGFLTGART 138 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 229 RFQSSQLSTQAIRXPSRPWW 288 R + Q+ T A P RP+W Sbjct: 29 RIWNIQMETPADHNPERPFW 48 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 21.4 bits (43), Expect = 7.1 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +1 Query: 274 SRPWWE 291 SRPWWE Sbjct: 79 SRPWWE 84 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = +1 Query: 49 LLRRIGHGCRKQSSRGGQ*WCSIG 120 L+ HGC GG C +G Sbjct: 112 LVPEYSHGCMSPEQGGGLLQCKVG 135 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +1 Query: 10 TLTLFDNESFRVFLLRRIGHG 72 +L +F+N+ F L + + HG Sbjct: 388 SLKIFNNQEFAQLLSQSVNHG 408 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = +2 Query: 173 PSNGPSGNYEPISTGPAFVDFNHPNYPP 256 P N P+STG ++ H PP Sbjct: 1924 PYKATGQNDGPLSTGVTIAEYGHWVAPP 1951 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -1 Query: 97 HHVNSVCGSHGQYGEEEKHES 35 HHV+ + HG Y + H + Sbjct: 42 HHVHMMPEMHGAYSQVHHHRA 62 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -1 Query: 97 HHVNSVCGSHGQYGEEEKHES 35 HHV+ + HG Y + H + Sbjct: 42 HHVHMMPEMHGAYSQVHHHRA 62 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +2 Query: 152 PDPFFSQPSNGPSGNYEPI 208 P P P GP+G+ P+ Sbjct: 595 PSPLAGGPLGGPAGSRPPL 613 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 21.0 bits (42), Expect = 9.4 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 104 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGP 220 S + +D N +V D Q N P+ + PIS+ P Sbjct: 102 STLGADSNFGSLVNGAVDTCARQIQNDPAYSVAPISSSP 140 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 194 HYAAPIAHHAAP 205 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 196 HYAAPIAHHAAP 207 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 232 HYAAPIAHHAAP 243 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 194 HYAAPIAHHAAP 205 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 131 HYCRPMEHHYCP 96 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 322,189 Number of Sequences: 2352 Number of extensions: 6640 Number of successful extensions: 42 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 17819379 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -