BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K21 (467 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr 1||... 27 1.9 SPAC17A5.10 |||conserved fungal protein|Schizosaccharomyces pomb... 25 5.8 SPAC22A12.16 |||ATP-citrate synthase subunit 2 |Schizosaccharomy... 25 7.6 >SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 467 Score = 26.6 bits (56), Expect = 1.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 178 SHRSA*RRKDPGVAREGGGMGHAEYLRDLPLPGQ 279 S +SA GV + GGG+ H + RDL L G+ Sbjct: 99 SQKSAYGYLQVGVEKYGGGIWHTWFDRDLSLAGR 132 >SPAC17A5.10 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 224 Score = 25.0 bits (52), Expect = 5.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 162 YTRALFSPQRITSQRPRSCARGRGN 236 Y++A + P R TSQRP S G + Sbjct: 67 YSQAPYPPARPTSQRPNSWQPGNAS 91 >SPAC22A12.16 |||ATP-citrate synthase subunit 2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 492 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 5 PEGVGFKTTGERDGETKFGEFPWMV 79 PE +G KT+GE G P MV Sbjct: 273 PESLGIKTSGEESGAINADHGPPMV 297 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,052,392 Number of Sequences: 5004 Number of extensions: 41289 Number of successful extensions: 116 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 178394480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -