BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K18 (484 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 28 0.19 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 4.2 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 27.9 bits (59), Expect = 0.19 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 7/39 (17%) Frame = -3 Query: 167 LSFIFFCEM-------FNDSFSTRYTDSWIAVCQEYDNR 72 ++FI +C M FND F R D W+AV Q D + Sbjct: 372 INFILYCSMSRQFRSTFNDLFRPRILDRWMAVPQGDDEQ 410 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 4.2 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 240 LNDGFSRRIYEAADAALQLSDFYRQVSSPLLAHVNFVYPSD 362 ++D R I A DA ++ YR+V LLA P D Sbjct: 703 IDDQDRRMIETATDAMIEQVAIYREVEKLLLAKCRNGEPPD 743 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 476,698 Number of Sequences: 2352 Number of extensions: 8660 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42285900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -