BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K18 (484 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 24 0.98 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 24 0.98 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 6.9 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 9.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 9.1 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 23.8 bits (49), Expect = 0.98 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 65 PGTYYHIPDRRRSNCRCN 118 PGT + PDR++ +CN Sbjct: 651 PGTRFFYPDRKQVILKCN 668 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.8 bits (49), Expect = 0.98 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 65 PGTYYHIPDRRRSNCRCN 118 PGT + PDR++ +CN Sbjct: 741 PGTRFFYPDRKQVILKCN 758 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.0 bits (42), Expect = 6.9 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 72 PIIIFLTDGDPTVGVTSTKTIIKHLTEK 155 P I+ + D GVT+ I H T K Sbjct: 105 PDIVLYNNADGEYGVTTMTKAILHYTGK 132 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 20.6 bits (41), Expect = 9.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 150 EKNKGENKATM 182 EKN G NK TM Sbjct: 145 EKNAGNNKITM 155 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 20.6 bits (41), Expect = 9.1 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 306 KSHSVEAPRQLPRRYVARNHR*EGTTFVKTYCLHRLLNR 190 K + ++ PRQ V R R TT++ + L L +R Sbjct: 433 KKNKLKKPRQGDGAAVKRKSREGSTTYLWEFLLKLLQDR 471 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,110 Number of Sequences: 438 Number of extensions: 2835 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13174803 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -