BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K15 (492 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 31 0.004 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 27 0.092 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 27 0.092 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 27 0.092 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 25 0.28 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 23 2.0 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 2.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 2.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 2.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 2.6 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 3.5 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 22 3.5 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 4.6 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 8.0 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 8.0 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 31.5 bits (68), Expect = 0.004 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +2 Query: 332 TALRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGV 448 TA+RDP FY+ ++ I +K L Y + +L++ G+ Sbjct: 392 TAMRDPIFYRWHSYIDDIFQEYKATLPRYTENQLNYPGI 430 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 27.1 bits (57), Expect = 0.092 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 348 LHSISYITGLWVTLTHSSIT 407 +H+ SY+TG+WV L + S T Sbjct: 123 IHTSSYMTGIWVWLINISAT 142 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/45 (24%), Positives = 17/45 (37%) Frame = +3 Query: 255 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTL 389 +AMC + + + + S P L F P L W+ L Sbjct: 178 IAMCGMYYRDECSFAESIPPYLFFVPPPLMFLQDFLSHQHAWIWL 222 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 27.1 bits (57), Expect = 0.092 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 348 LHSISYITGLWVTLTHSSIT 407 +H+ SY+TG+WV L + S T Sbjct: 356 IHTSSYMTGIWVWLINISAT 375 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/45 (24%), Positives = 17/45 (37%) Frame = +3 Query: 255 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTL 389 +AMC + + + + S P L F P L W+ L Sbjct: 411 IAMCGMYYRDECSFAESIPPYLFFVPPPLMFLQDFLSHQHAWIWL 455 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 27.1 bits (57), Expect = 0.092 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 348 LHSISYITGLWVTLTHSSIT 407 +H+ SY+TG+WV L + S T Sbjct: 356 IHTSSYMTGIWVWLINISAT 375 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/45 (24%), Positives = 17/45 (37%) Frame = +3 Query: 255 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTL 389 +AMC + + + + S P L F P L W+ L Sbjct: 411 IAMCGMYYRDECSFAESIPPYLFFVPPPLMFLQDFLSHQHAWIWL 455 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 25.4 bits (53), Expect = 0.28 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 338 LRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGV 448 LRDP F++ + I FK L Y +L++ GV Sbjct: 394 LRDPLFFRWHAYIDDMFQEFKATLPRYTVAQLNYPGV 430 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 22.6 bits (46), Expect = 2.0 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -3 Query: 352 CRVSKCGLVKVKRTGHE-GVLVEWFR 278 CR+ KC LV + ++G G WF+ Sbjct: 61 CRLRKCLLVGMSKSGSRYGRRSNWFK 86 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 392 AFKHYLKPYPQEKLHFVGV 448 AF H+L + E LH VG+ Sbjct: 163 AFSHFLIVFFTETLHTVGI 181 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 392 AFKHYLKPYPQEKLHFVGV 448 AF H+L + E LH VG+ Sbjct: 163 AFSHFLIVFFTETLHTVGI 181 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 392 AFKHYLKPYPQEKLHFVGV 448 AF H+L + E LH VG+ Sbjct: 163 AFSHFLIVFFTETLHTVGI 181 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 392 AFKHYLKPYPQEKLHFVGV 448 AF H+L + E LH VG+ Sbjct: 163 AFSHFLIVFFTETLHTVGI 181 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 3.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 292 VEWFRCCTEHMASDNFIRSLIILCNFFFIQIGVL 191 ++W R +AS FI I LC+ + IG + Sbjct: 275 IKWTRIAYMALASVPFIFDSIHLCDVCYSTIGTV 308 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 21.8 bits (44), Expect = 3.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 292 VEWFRCCTEHMASDNFIRSLIILCNFFFIQIGVL 191 ++W R +AS FI I LC+ + IG + Sbjct: 293 IKWTRIAYMALASVPFIFDSIHLCDVCYSTIGTV 326 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.4 bits (43), Expect = 4.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 232 IILCNFFFIQIGVLLPIVSDKVNCLFIV 149 I C FF I +LL I + LFI+ Sbjct: 407 ITACKFFSIDNALLLSICGASSSYLFIM 434 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 20.6 bits (41), Expect = 8.0 Identities = 21/106 (19%), Positives = 45/106 (42%), Gaps = 4/106 (3%) Frame = +3 Query: 147 STMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAM-CSVQHLNHSTSTPSCPVRLT 323 S+++ + + GKRTP+ + K+ + + + + + CS + P Sbjct: 236 SSLRPRSSQKSAPGKRTPLISRAKINTVKQTIAVIVMYIACSTPFILAQLWATWDPQSPF 295 Query: 324 FTKPHF---ETLHSISYITGLWVTLTHSSIT*SLILKRNFISSALN 452 P F L+S++ W+ L + L+L R++ +S+ N Sbjct: 296 IDGPVFVILTLLYSLNSCVNPWIYLAFNRELPRLLL-RHYTASSKN 340 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -2 Query: 164 LPFHRGNQFSCHTIRICL 111 + FH G+Q HT++ L Sbjct: 378 ITFHIGSQLVLHTVKTVL 395 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,579 Number of Sequences: 336 Number of extensions: 2511 Number of successful extensions: 18 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11525470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -