BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K12 (545 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 28 0.061 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 5.3 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 7.0 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 9.3 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 27.9 bits (59), Expect = 0.061 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Frame = -3 Query: 294 NLFTIRKRSFGVPNL-----LRQFPKRTQVGKVLVYLKRNNYQFSSILHNNV 154 N++T KR P L L +P RTQ+ +V + + YQ +L N V Sbjct: 465 NIYTSSKRQRTSPQLSPMSSLPPYPNRTQITEVTQQTEPSIYQHDQLLRNKV 516 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.4 bits (43), Expect = 5.3 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -3 Query: 291 LFTIRKRSFGVPNLLRQFPKRTQVGKVLVYLKRNNYQFSSILHNNV 154 +F +++ + V L K T + K L Y YQ S ++ NN+ Sbjct: 117 VFRLKQLNAKVEMLKNARVKNTALWKQLRYEHYRLYQLSVLIDNNM 162 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 7.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 428 IQLESSYIIVNARLVVSTCIQESV 357 + L++ YII+N RL+ +SV Sbjct: 826 LMLKNRYIILNGRLIKMETKAQSV 849 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 20.6 bits (41), Expect = 9.3 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -3 Query: 336 NIKLFIIEQSYTN*NLFTIRKRS 268 N ++F I++SY+ N + R+RS Sbjct: 10 NREMFAIKKSYSIENGYPARRRS 32 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,591 Number of Sequences: 336 Number of extensions: 1805 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -