BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K10 (590 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U61947-5|AAB03134.1| 723|Caenorhabditis elegans Hypothetical pr... 28 4.3 Z98877-9|CAB63405.1| 348|Caenorhabditis elegans Hypothetical pr... 27 7.5 >U61947-5|AAB03134.1| 723|Caenorhabditis elegans Hypothetical protein C06G3.4 protein. Length = 723 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +1 Query: 403 APKYDSRGFEIPLHVNSENFFLLNHFIHELPAGESVIVKESTENLFTV 546 A + D + L SE+ +LN+F+ EL E++ V +STE F V Sbjct: 274 ALRLDFTYYHKELKAASESVTILNNFLDELFRKETIWVPDSTEWYFIV 321 >Z98877-9|CAB63405.1| 348|Caenorhabditis elegans Hypothetical protein Y69H2.8 protein. Length = 348 Score = 27.5 bits (58), Expect = 7.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 432 DPTTCQLREFLPAESLHSRIACRRKRD 512 DP Q+R+ L SL SR++ RR D Sbjct: 88 DPRAIQIRDLLGPRSLSSRLSSRRNLD 114 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,442,519 Number of Sequences: 27780 Number of extensions: 241059 Number of successful extensions: 674 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1247656244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -