BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K09 (605 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 42 4e-04 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) 41 9e-04 SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) 41 9e-04 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 40 0.001 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 38 0.005 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 38 0.005 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 36 0.019 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 36 0.019 SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) 36 0.019 SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) 36 0.034 SB_15403| Best HMM Match : CH (HMM E-Value=0) 36 0.034 SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 35 0.059 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 34 0.078 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.078 SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) 33 0.14 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 33 0.14 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) 33 0.14 SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) 32 0.41 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 31 0.55 SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_21821| Best HMM Match : MRG (HMM E-Value=0) 30 1.7 SB_52864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) 29 3.9 SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) 28 5.1 SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) 28 6.7 SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_52816| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_19553| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) 27 8.9 SB_33373| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC--GVKVTLARQAPCP 536 +C + C T EY P CG+D TY N+ + Q+C G K+ LA PCP Sbjct: 278 ECPKAC--TREYKPACGTDGNTYPNR-CVLAIQSCETGEKLQLAHDGPCP 324 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/51 (43%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPCP 536 +C + C T +Y PVCGSDNKTY N L C K+ L PCP Sbjct: 195 ECPKVC--TLDYTPVCGSDNKTYANLCNLEVEACKPENTDKLQLLHDGPCP 243 Score = 37.5 bits (83), Expect = 0.008 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 381 QTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC--GVKVTLARQAPCPSSS 545 Q + C E C T EY PVCGSD KTY N L ++C ++++ ++ C S+ Sbjct: 37 QPVCVCNEAC--TREYAPVCGSDGKTYPNPCALE-VESCKTNTRISVIKKGSCDDSA 90 Score = 36.7 bits (81), Expect = 0.015 Identities = 20/49 (40%), Positives = 25/49 (51%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPS 539 +C C T E PVCG+D KTY N L A + LA + PCP+ Sbjct: 117 ECPRAC--TRELMPVCGTDQKTYDNMCLLERAACKDDGLMLAHEGPCPT 163 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 41.1 bits (92), Expect = 7e-04 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVK--VTLARQAPC 533 C +NC ST + PVCGSD KTYKN+ L A C K VT+A Q C Sbjct: 3970 CNKNCPSTSK--PVCGSDGKTYKNECELKRAA-CESKKNVTVASQGEC 4014 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKN 467 +C C+ P+ PVCG+D KTY+N Sbjct: 4236 ECPSRCL--PDKEPVCGADGKTYRN 4258 >SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) Length = 77 Score = 40.7 bits (91), Expect = 9e-04 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 393 KCAEN-CISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCP 536 KC ++ + T +Y+PVCGSD KTY N L A C + + + CP Sbjct: 24 KCDDSPTLCTLQYDPVCGSDGKTYGNMCFLKAAIKCNPDLYMKHKGACP 72 >SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) Length = 143 Score = 40.7 bits (91), Expect = 9e-04 Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLA--RQAPCPSSSK 548 C ENC ST + PVCG+DN TY N+ L Q C T+A R+ C SK Sbjct: 27 CPENCSSTVD--PVCGTDNNTYDNE-CLMRQQACVANATVAVRRKGHCDPCSK 76 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/56 (42%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQ-----APCPSSSK 548 C ENC ST + PVCG+DN TY N+ L Q C T+A + PCP + K Sbjct: 161 CPENCSSTVD--PVCGTDNNTYDNE-CLMRQQACVANATVAVRRKGHCEPCPKTLK 213 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/48 (47%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLA--RQAPC 533 C ENC ST + PVCGSDN TY N+ L Q C T+A R+ C Sbjct: 275 CPENCSSTVD--PVCGSDNNTYDNE-CLMRQQACVANTTVAVRRKGDC 319 Score = 29.9 bits (64), Expect = 1.7 Identities = 36/111 (32%), Positives = 41/111 (36%), Gaps = 5/111 (4%) Frame = +3 Query: 216 PNGSQFRMVTEFNTLWTTIIIL*PSFFLIKCSSQTKHRYQVKGKHQPPST-GGTSRQTIE 392 PN Q R FN WTT I P CS+ T P ST Q Sbjct: 42 PNECQMRQDACFNKQWTTPISCDP------CSNFT-------CDSPPYSTCKAQDDQPTC 88 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRL---FCAQNCGVKVT-LARQAPC 533 C E C T PV G+DNK Y N+ L C N + + R PC Sbjct: 89 VCVEPCPKT--LKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFGRYNPC 137 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/52 (46%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLA--RQAPCPSSS 545 C ENC ST + PVCGSDN TY N+ L Q C T+A R+ C S Sbjct: 1206 CPENCSSTVD--PVCGSDNNTYDNE-CLMRQQACVANTTVAVRRKGDCDPCS 1254 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPCPSSSK 548 C +C P+CGS+NKTY N+ L C N + + ++ P P K Sbjct: 289 CPSSCGDESLPQPICGSNNKTYANECELRMDSCKNNKSIAIQFRKECPAPCQGK 342 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLA 518 C ENC ST + PVCG+DN TY N+ L Q C T+A Sbjct: 1135 CPENCSSTVD--PVCGTDNNTYDNE-CLMRQQACVANATVA 1172 Score = 36.3 bits (80), Expect = 0.019 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDNKTYKNQ---GRLFCAQNCGVKVTLARQAPC 533 C ++C T E P+C SD +TY N+ + C N + VT R PC Sbjct: 2154 CPDDC--TNETKPICASDGQTYDNECLMQKRACENNQNLNVTSDRACPC 2200 Score = 35.5 bits (78), Expect = 0.034 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 4/65 (6%) Frame = +3 Query: 354 PPSTGGTSRQTIEKCAENCISTPEYN-PVCGSDNKTYKNQGRL---FCAQNCGVKVTLAR 521 PP + T++ C C P+ + PVCG++NKTY ++ L C N + V L + Sbjct: 663 PPYSSCTTKDNKPTCI--CPECPQVDKPVCGTNNKTYTSECALQVDACKTNTSIDVQLDK 720 Query: 522 QAPCP 536 PCP Sbjct: 721 --PCP 723 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTL 515 +C+E+C T PVCGSDN Y N+ L A+ C T+ Sbjct: 1372 ECSEDCPKT--LKPVCGSDNNDYDNE-CLMQARACATNKTI 1409 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 429 NPVCGSDNKTYKNQGRLFCAQNCGVK-VTLARQAPCPSSSK 548 +PVCGSD+KTY N+ R+ K + +A+Q C +K Sbjct: 617 DPVCGSDSKTYPNECRMRQEACWNNKWIIVAQQEECDPCNK 657 Score = 29.9 bits (64), Expect = 1.7 Identities = 36/111 (32%), Positives = 41/111 (36%), Gaps = 5/111 (4%) Frame = +3 Query: 216 PNGSQFRMVTEFNTLWTTIIIL*PSFFLIKCSSQTKHRYQVKGKHQPPST-GGTSRQTIE 392 PN Q R FN WTT I P CS+ T P ST Q Sbjct: 1016 PNECQMRQDACFNKQWTTPISCDP------CSNFT-------CDSPPYSTCKAQDDQPTC 1062 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRL---FCAQNCGVKVT-LARQAPC 533 C E C T PV G+DNK Y N+ L C N + + R PC Sbjct: 1063 VCVEPCPKT--LKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFGRYNPC 1111 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 420 PEYNPVCGSDNKTYKNQ-GRLFCAQNCGVKVTLARQAPC 533 P PVCGSD TY+++ G + A +TL C Sbjct: 2631 PTLTPVCGSDGVTYESECGMIQKACQTNTSITLVANEAC 2669 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDNKTYKNQGRL--FCAQNCGVKVTLARQAPC 533 C + C T +PVC SDN TY N+ + Q+ V +T R+ C Sbjct: 1580 CPKICPIT--LDPVCASDNNTYPNECAMKQLACQSAKV-LTFRRKGDC 1624 >SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +3 Query: 408 CISTPEYN-PVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPC 533 C+S P+ N PVCGS+ K Y N+ L A +T+AR++PC Sbjct: 205 CMSCPKMNKPVCGSNGKDYNNECELQQFACKTNTMITVARRSPC 248 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +3 Query: 408 CISTPEY-NPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPCPSSSK 548 C+S P +PVCGSD K Y N+ L A +T+ R+ C S+++ Sbjct: 111 CLSCPNILDPVCGSDGKNYDNECNLRQNACKTNTLITVVRRDACLSTAR 159 Score = 31.9 bits (69), Expect = 0.41 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +3 Query: 408 CISTPEY-NPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPCP 536 C+S P +PVCGSD K Y N +L A +TL + CP Sbjct: 274 CLSCPNMLDPVCGSDGKNYDNVCKLRQNACKTNTLITLISRDACP 318 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 38.3 bits (85), Expect = 0.005 Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = +3 Query: 369 GTSRQTIEKCAENCISTPEYNPVCGSDNKTYKNQ---GRLFCAQNCGVKVTLARQAPC 533 G S C+ I T EY+P+CGSD KTY NQ R C QN + + PC Sbjct: 5143 GCSVNNKATCSCPDICTFEYSPLCGSDGKTYDNQCEMERASCLQNKDLTGKPGKCDPC 5200 Score = 35.5 bits (78), Expect = 0.034 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +3 Query: 354 PPSTGGTSRQTIEKCAENCISTPEYNPVCGSDNKTYKNQ 470 PP + T+ C N I T EY PVCG+D ++Y N+ Sbjct: 5208 PPYSECTAINGSPVCTCNSICTLEYAPVCGTDGQSYDNE 5246 Score = 34.3 bits (75), Expect = 0.078 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +3 Query: 408 CISTPEY-NPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPCP 536 C+S P +PVCGSD K Y N+ L A +T+ R+ CP Sbjct: 5790 CLSCPNILDPVCGSDGKNYDNECNLRQNACKTNTLITVVRRDACP 5834 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +3 Query: 408 CISTPEYN-PVCGSDNKTYKNQGRL 479 C S P N PVCGSD KTY N+ L Sbjct: 5621 CQSCPSINKPVCGSDGKTYNNECEL 5645 Score = 31.9 bits (69), Expect = 0.41 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +3 Query: 354 PPSTGGTSRQTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAP 530 PP + +R +C + I + Y PVCG+D + Y N+ L A + +A + Sbjct: 5279 PPYSYCKARDGRPECVCDGICSLVYAPVCGTDGQEYSNECNLQIASCRKNELIEVASRGS 5338 Query: 531 CPSS 542 CP++ Sbjct: 5339 CPTT 5342 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +3 Query: 423 EYNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPC 533 +Y PVCG+D +TY+N+ L C +N +V +A Q C Sbjct: 5558 DYTPVCGTDGETYENECTLQISSCQRN--EQVEVASQGHC 5595 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 38.3 bits (85), Expect = 0.005 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +3 Query: 342 GKHQPPSTGGTSRQTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFC-AQNCGVKVTLA 518 GK+ S G +RQ + C ++ PVCGSD +TY N RL G VT+ Sbjct: 418 GKNCVTSHQGLTRQAVCACPRFEDCPRDFRPVCGSDLRTYVNLCRLQVEVCQTGRAVTVL 477 Query: 519 RQAPCPSSS 545 RQ C S Sbjct: 478 RQGACDPCS 486 Score = 33.9 bits (74), Expect = 0.10 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +3 Query: 417 TPEYNPVCGSDNKTYKNQ---GRLFCAQNCGVKVTLARQAPCPSSS 545 T +Y PVCG D K+Y + RL C + GV + +A + CP S Sbjct: 1758 TLKYTPVCGDDGKSYLSTCMLKRLACLK--GVHIAIASKGRCPCKS 1801 Score = 32.7 bits (71), Expect = 0.24 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = +3 Query: 423 EYNPVCGSDNKTYKNQGRL---FCAQNCGVKV 509 E +PVCGSD KTY+N+ +L C N V++ Sbjct: 516 EASPVCGSDGKTYENECKLRVESCKANQNVRI 547 Score = 31.9 bits (69), Expect = 0.41 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +3 Query: 426 YNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPCPSSS 545 Y+PVCGS+ KTY N L C +N +K+ + C S++ Sbjct: 1830 YDPVCGSNRKTYLNFCSLTAEACKKNLPIKMAYKGRCCCASTT 1872 Score = 31.5 bits (68), Expect = 0.55 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRLFC-AQNCGVKVTLARQAPC 533 KC+ P PVCGSD K+Y ++ L A +K+TL + C Sbjct: 1679 KCSCPIYCPPSGQPVCGSDGKSYGSECELRKEACEAKIKLTLVSKGKC 1726 Score = 30.7 bits (66), Expect = 0.96 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +3 Query: 405 NCISTPEYNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPC 533 +C P+ PVCG+DNK Y N+ L CA N ++V + PC Sbjct: 816 SCDKMPD--PVCGTDNKEYANECLLNVAACAANIHLRV--LNKGPC 857 Score = 30.7 bits (66), Expect = 0.96 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Frame = +3 Query: 306 CSSQTKHRYQVKGKHQPPSTGGTSRQTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFC 485 CS T HRY H GT+ + C+ C Y PVCG+D +T+ N L Sbjct: 1515 CSKVTCHRYAKCNNHY----NGTASCS---CSSRCPLV--YKPVCGTDMETHIN-ACLLK 1564 Query: 486 AQNCGVK--VTLARQAPC 533 ++C ++ + +A PC Sbjct: 1565 LKSCQIESDLDVAYSGPC 1582 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDNKTYKN 467 C NC S +++PVCG D TY+N Sbjct: 579 CPTNCPS--DWDPVCGDDGVTYQN 600 Score = 27.9 bits (59), Expect = 6.7 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 381 QTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTL 515 Q I C E C T ++ VCGS+ +TY N L + +C ++ T+ Sbjct: 1886 QAICVCDEKC--TFAFDAVCGSNGRTYIND-CLLRSDSCKLRKTI 1927 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 36.3 bits (80), Expect = 0.019 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 390 EKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPCPSS 542 +KCA C Y PVCGSDN TY N L A +T+ + C SS Sbjct: 167 DKCAPIC--NKMYQPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSS 216 Score = 35.5 bits (78), Expect = 0.034 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKN 467 +C C T E NPVCGSD KTY N Sbjct: 117 RCMRRC--TKELNPVCGSDGKTYDN 139 Score = 32.3 bits (70), Expect = 0.31 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +3 Query: 387 IEKCAENCISTPEYNPVCGSDNKTYKNQ---GRLFCAQNCGVKVTLARQAPC 533 ++ C C + Y PVCG+D KTY N+ G C N G +TLA C Sbjct: 41 VDPCVRPCPAI--YMPVCGTDGKTYGNKCMLGAATCRSN-GT-ITLAYPGEC 88 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 36.3 bits (80), Expect = 0.019 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 390 EKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPCPSS 542 +KCA C Y PVCGSDN TY N L A +T+ + C SS Sbjct: 24 DKCAPIC--NKMYQPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSS 73 >SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) Length = 87 Score = 36.3 bits (80), Expect = 0.019 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +3 Query: 405 NCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQ-----APCPSSSK 548 NC ST + PVCGSDN TY N+ L Q C T+A + PCP + K Sbjct: 2 NCSSTVD--PVCGSDNNTYDNE-CLMRQQACVANTTVAVRRKGDCEPCPKTLK 51 >SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) Length = 92 Score = 35.5 bits (78), Expect = 0.034 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +3 Query: 387 IEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVK--VTLARQAPCPSS 542 I +C N T Y PVCG+D KTY N+ L A C + V LA + C S+ Sbjct: 34 IVRCVCNRACTKIYRPVCGTDGKTYGNKCVLEIA-TCESEGAVQLAHEGECDSA 86 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +3 Query: 351 QPPSTGGTSRQTIE---KCAENCISTPEYNPVCGSDNKTYKN 467 QP GG + + KC + T EY PVCGSD TY N Sbjct: 704 QPCKYGGVCQAGADGKTKCVCSAACTREYAPVCGSDGNTYNN 745 Score = 35.5 bits (78), Expect = 0.034 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLAR--QAPC 533 +C + P Y+P+CG+D KTY N L A C + ++ R + PC Sbjct: 1232 RCECDLRPDPAYDPICGTDGKTYNNDKDLESAA-CAQQTSIVRWHKGPC 1279 Score = 28.7 bits (61), Expect = 3.9 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +3 Query: 357 PSTGGTSRQTIEKCAENCISTPEYNPVCGSDNKTYKNQ 470 PS G+ I +C +C S Y PVCG D +TY N+ Sbjct: 962 PSADGSGH--ICECPRSCPSV-NY-PVCGDDGQTYDNE 995 >SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 35.5 bits (78), Expect = 0.034 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = +3 Query: 417 TPEYNPVCGSDNKTYKNQGRL---FCAQNCGVKV 509 T +YNPVCGSD +TY N+ + C +N +K+ Sbjct: 15 TADYNPVCGSDGRTYPNRASMEVQGCLKNTVLKI 48 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 34.7 bits (76), Expect = 0.059 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +3 Query: 432 PVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPCPSS 542 PVCGSD KTY N+ + A +T++ PCP + Sbjct: 1078 PVCGSDGKTYNNECLMRAASCKANKNITVSSYFPCPET 1115 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +3 Query: 408 CISTPEYN-PVCGSDNKTYKNQGRLFCAQNC--GVKVTLARQAPCP 536 C S P N PVCGSD Y ++ L Q C +T+ + PCP Sbjct: 285 CRSCPLINIPVCGSDGAQYDSECAL-QQQACQTDTDITVISEGPCP 329 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = +3 Query: 408 CISTPE----YNPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPCPSSS 545 C+ P+ Y+PV GSD K Y N+ L A ++ LA + P++S Sbjct: 758 CVCPPKCEKVYDPVYGSDGKNYDNECELKRAACTSNRRIILAGRGRVPTTS 808 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = +3 Query: 408 CISTPE----YNPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPCPSSS 545 C+ P+ Y+PV GSD K Y N+ L A ++ LA + P++S Sbjct: 877 CVCPPKCEKVYDPVYGSDGKNYDNECELKRAACTSNRRIILAGRGRVPTTS 927 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +3 Query: 405 NCISTPE----YNPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPCPSSSK 548 +C+ P+ Y+PV GSD K Y N+ L A ++ LA + P++++ Sbjct: 1442 SCVCPPKCEKVYDPVYGSDGKNYDNECELKRAACTTNKRIILAGRGRVPTTTE 1494 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 34.3 bits (75), Expect = 0.078 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +3 Query: 381 QTIEKCAENCISTPEYNPVCGSDNKTYKNQGRL---FCAQNCGVKV 509 Q + +C C T EY PVCGSD KTY + + C++N +KV Sbjct: 42 QPVCECPMAC--TREYAPVCGSDGKTYPTECVMQVDACSKNKDIKV 85 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 34.3 bits (75), Expect = 0.078 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC--GVKVTLARQAPCPSS 542 KC C T EY PVCG+D KTY N+ + A C VT+A C S+ Sbjct: 1294 KCPIFC--TYEYMPVCGTDGKTYGNKCEM-RASACLKSTMVTVAYPGECESN 1342 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPCPSS 542 KC + + T +Y PVC SD KTY N+ + C +N +++ Q CP + Sbjct: 1522 KCRQ--MMTADYTPVCASDGKTYPNRMSMENAGCEKNMILRI--VSQGECPKA 1570 Score = 32.3 bits (70), Expect = 0.31 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQ 470 +C ++T EY PVC SD K Y N+ Sbjct: 1966 ECVCRTVTTLEYRPVCASDGKIYPNR 1991 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 435 VCGSDNKTYKNQGRLF-CAQNCGVKVTLARQAPCPSSSK 548 VCGSD TY N+ L A +T+ Q PCP + K Sbjct: 1452 VCGSDRMTYSNECTLTQTACQESKNLTVVSQGPCPPNPK 1490 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRL 479 KC + I +P +PVCGSD K YK+ L Sbjct: 1753 KCPPS-ICSPVISPVCGSDGKIYKDDCEL 1780 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +3 Query: 426 YNPVCGSDNKTYKNQGRLFCAQNC--GVKVTLARQAPCPSSSK 548 Y+PVC S+ KTY N+ + A C K+T+ Q C K Sbjct: 1604 YDPVCASNGKTYSNRCDM-DADACIRDTKLTVVSQGACAKLGK 1645 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 417 TPEYNPVCGSDNKTYKN 467 T +Y+PVC SD +TY N Sbjct: 1818 TADYSPVCASDGQTYPN 1834 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQ 470 +C I Y+PVCGSD Y N+ Sbjct: 1364 QCVCPSICPLHYSPVCGSDGNMYSNE 1389 >SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) Length = 85 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 390 EKCAENCISTPEYNPVCGSDNKTYKN 467 +KCA C Y PVCGSDN TY N Sbjct: 38 DKCAPICPKI--YRPVCGSDNVTYSN 61 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 33.5 bits (73), Expect = 0.14 Identities = 28/86 (32%), Positives = 38/86 (44%), Gaps = 5/86 (5%) Frame = +3 Query: 291 FFLIKCSSQTKHRYQVKGKHQPPSTGGTSRQTIEKCAENCISTPEYNPVCGSDNKTYKNQ 470 F + KC ++ R ++K K++ G T K + PVCGSD KTY N Sbjct: 204 FLVAKCKAKKDGR-RLKLKYR----GACGNPTPRKSCPPRTCPKQDKPVCGSDGKTYTNG 258 Query: 471 GRLF---CAQNCGVK--VTLARQAPC 533 L CA G K +TL + PC Sbjct: 259 CELATAKCALPKGQKRQLTLKHRGPC 284 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +3 Query: 366 GGTSRQTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVK 506 G RQ + C + + P+CG D KTY+N LF C K Sbjct: 169 GKPKRQVV--CPQESQCDLKNRPICGEDEKTYRNL-CLFLVAKCKAK 212 Score = 28.7 bits (61), Expect = 3.9 Identities = 18/63 (28%), Positives = 29/63 (46%) Frame = +3 Query: 303 KCSSQTKHRYQVKGKHQPPSTGGTSRQTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLF 482 KC+ + Q+ KH+ P T + C + +PVCGSD TY+++ L Sbjct: 265 KCALPKGQKRQLTLKHRGPCGAPI---TAKPCMTKQKCRRKRDPVCGSDGVTYRSKCHLR 321 Query: 483 CAQ 491 A+ Sbjct: 322 VAK 324 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +3 Query: 393 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 533 +C E C S E +PVCG+D +TY ++ L A+ G KV + + C Sbjct: 205 RCHEPCPS--EASPVCGTDMRTYASRCHLQLAKCKGHKVKMIYKGRC 249 >SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) Length = 69 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +3 Query: 387 IEKCAENCISTPEYN-PVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPC 533 ++KC C P N PVCG+D KTY N+ L A + +TLA C Sbjct: 21 VDKCVRPC---PAINDPVCGTDGKTYGNECMLGAATCHSNGTITLAYPGEC 68 >SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) Length = 98 Score = 31.9 bits (69), Expect = 0.41 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +3 Query: 387 IEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVK--VTLARQAPC 533 I +C N Y+P+CG+D KTY N+ L A C + V LA + C Sbjct: 34 IARCVCNRACKKIYSPMCGTDGKTYGNKCMLEIA-TCESEGAVKLAHEGEC 83 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 31.5 bits (68), Expect = 0.55 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +3 Query: 360 STGGTSRQTIEKCAENCISTPEYNPVCGSDNKTY-KNQGRLFCAQNCGVKVTLARQAPC 533 S+GG++ C +C T Y+PVCG D TY N R+ A N + PC Sbjct: 243 SSGGSANCV---CPSDCSHT--YSPVCGGDKTTYINNCTRIAAACNMKKDIPFNVNGPC 296 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/65 (27%), Positives = 31/65 (47%) Frame = +3 Query: 336 VKGKHQPPSTGGTSRQTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTL 515 V+ K + G + +C C S E +PVCG D +TY + + A+ C + ++ Sbjct: 783 VECKFKARCVGLPDGSAVCECNTECPS--EASPVCGQDGRTYSSTCAM-DARACQAQTSI 839 Query: 516 ARQAP 530 A + P Sbjct: 840 AVKHP 844 >SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 31.5 bits (68), Expect = 0.55 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Frame = +3 Query: 393 KCAENCIST-PEY-NPVCGSDNKTYKNQ---GRLFCAQNCGVKVTLARQAPC 533 K + C+S P++ PVCGSD TY N R+ C K+T+ + PC Sbjct: 76 KASCECLSECPDHIKPVCGSDGVTYPNHCELHRIACVHT--KKITIRSKGPC 125 >SB_21821| Best HMM Match : MRG (HMM E-Value=0) Length = 292 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +2 Query: 92 YTGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIP 229 Y G + +A C+ + K E A I NGWNK+ D EW+P Sbjct: 16 YHGPLIYEAKCIRGQLK---EKTARYLIHYNGWNKNWD----EWVP 54 >SB_52864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/65 (30%), Positives = 29/65 (44%) Frame = +3 Query: 234 RMVTEFNTLWTTIIIL*PSFFLIKCSSQTKHRYQVKGKHQPPSTGGTSRQTIEKCAENCI 413 R T +T W + P + + TKH + V+ +QP G T R+ E+C Sbjct: 75 RRTTYLSTQWVHV----PRGYRKMYEANTKH-FDVQLTYQP--NGYTCREDTERCTRRTR 127 Query: 414 STPEY 428 STP Y Sbjct: 128 STPTY 132 >SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) Length = 1376 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 Query: 336 VKGKHQPPSTGGTSRQTIEKCAENCISTPEYNPVC 440 VK P S T R C +CISTP Y+ +C Sbjct: 1178 VKENSLPQSPQETPRSCA--CVHSCISTPRYDQIC 1210 >SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) Length = 396 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +3 Query: 393 KCAENCISTPEYNPV-CGSDNKTYKN 467 +CAE+C P Y+ CGSD TYKN Sbjct: 20 ECAESC---PTYDDERCGSDGVTYKN 42 >SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +3 Query: 393 KCAENCISTPEYNPV-CGSDNKTYKN 467 +CAE+C P Y+ CGSD TYKN Sbjct: 174 ECAESC---PTYDDERCGSDGVTYKN 196 >SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) Length = 68 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 396 CAENCISTPEYNPVCGSDNKTYKN 467 C+ +C PVCGSD+ TY N Sbjct: 8 CSFSCDDGFHQTPVCGSDDVTYAN 31 >SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1376 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +2 Query: 68 EMDTVRASYTGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQ 235 + DT+R + +SQA C +IR ++ +NN N + + ++ PE +P++ Sbjct: 774 QQDTLRKRISTTDSSQAVCTSIRELQEEKNNGNETPSPDTKDNTEGTTSPE-VPVR 828 >SB_52816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1622 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 420 PEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC-PSSS 545 P+YN V SD + N +F ++ CG+ + C P SS Sbjct: 1326 PDYNSVESSDANSETNGNGIFSSKFCGLSAACSTCCKCKPESS 1368 >SB_19553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1744 Score = 27.5 bits (58), Expect = 8.9 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +3 Query: 342 GKHQPPSTGGTSRQTIEKCAENCISTPEYNPVCGSDNKTYKNQGR 476 G+ P + G TS + C + + VC S NKT + R Sbjct: 677 GRGYPHAGGKTSCPAYQAVCRGCAKSNHFEAVCRSKNKTPDRKSR 721 >SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +3 Query: 387 IEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPCPSSS 545 + C+ +C S+P VCG+D TY + RL A G + +A C S Sbjct: 128 VSNCS-SCNSSPADTEVCGADGVTYGSLCRLRVATCKLGKTIGVAYLGSCKEGS 180 >SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) Length = 262 Score = 27.5 bits (58), Expect = 8.9 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = +3 Query: 348 HQPPSTGGTSRQTIEKCAENCISTP-EYNPVCGSDNKTYKNQ-GRLFC-AQNCGVKV 509 HQ TG S C C+ TP Y C + +T GR+ C QN V V Sbjct: 121 HQDAQTGNNSCSLRSPCDFLCLPTPNSYQCACPDNMRTVNGMFGRIICRCQNGEVLV 177 >SB_33373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 720 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = +3 Query: 408 CISTPE----YNPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPCPSSS 545 C+ P+ Y+PV GSD K Y N+ L A ++ LA + P++S Sbjct: 26 CVCPPKCEKVYDPVYGSDGKNYDNECELKRAACTSNRRIILAGRGRVPTTS 76 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +3 Query: 405 NCISTPE----YNPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPCPSSSK 548 +C+ P+ Y+PV GSD K Y N+ L A ++ LA + P++++ Sbjct: 589 SCVCPPKCEKVYDPVYGSDGKNYDNECELKRAACTTNKRIILAGRGRVPTTTE 641 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,182,789 Number of Sequences: 59808 Number of extensions: 462604 Number of successful extensions: 1260 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1260 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -