BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K06 (544 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 4.6 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 6.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 6.1 AY352277-2|AAQ67419.1| 88|Apis mellifera EX4.8-5.8 protein. 21 8.1 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 8.1 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 4.6 Identities = 10/41 (24%), Positives = 17/41 (41%) Frame = +2 Query: 146 NDGGVLEHSGAMFIDSKINVYEQFKQDVQNTGVSEVNELPW 268 +DG E G + + + N + F++ N V PW Sbjct: 385 SDGNEAEVEGTLSVQPQANPVKGFEEYFLNLTVENNRRNPW 425 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 6.1 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -2 Query: 498 YIRLTFPIWLP 466 ++R FP WLP Sbjct: 235 FLRQAFPFWLP 245 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 6.1 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -2 Query: 498 YIRLTFPIWLP 466 ++R FP WLP Sbjct: 235 FLRQAFPFWLP 245 >AY352277-2|AAQ67419.1| 88|Apis mellifera EX4.8-5.8 protein. Length = 88 Score = 21.0 bits (42), Expect = 8.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 472 VTFRVVKWARFSIFVR 425 +TF V KW++ I VR Sbjct: 46 ITFGVNKWSKVCIVVR 61 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +2 Query: 455 YNTKGNQIGNVNLMYVTGTFNMTSVEQI 538 YN N N N Y +N+ +EQI Sbjct: 334 YNNYNNYNNNYNNNYKKLYYNINYIEQI 361 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,405 Number of Sequences: 438 Number of extensions: 3327 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15459066 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -