BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K03 (642 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 28 1.0 01_01_0106 + 788967-789555,790139-790162,790339-791411 28 5.5 01_05_0548 + 23149271-23149568,23149766-23149845,23150137-231502... 28 7.2 >03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 Length = 380 Score = 27.9 bits (59), Expect(2) = 1.0 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 469 NGISGNIGLNVDGNTERLVVESWLTNLEVVWVTS 368 NG + + G T+R+++ SWL+ LE+ + T+ Sbjct: 224 NGFTEAPETSNSGQTKRVLLSSWLSTLELAYTTA 257 Score = 21.4 bits (43), Expect(2) = 1.0 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -3 Query: 337 VSGIKLAIVKECD*FLNDNIIDFNADEMKFL 245 VSG ++A+ + L+ N++ + DEM L Sbjct: 298 VSGTRIALGDDGSIALSRNVVVLHVDEMLLL 328 >01_01_0106 + 788967-789555,790139-790162,790339-791411 Length = 561 Score = 28.3 bits (60), Expect = 5.5 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = +2 Query: 401 PRLNHKPFSVTIDVXSDIATDA--VIKIFLGPKYNDXGFPITLEENWHKFYELDWFTHKI 574 P L + F V I SD+ + V+++ G + D G +N H+ Y L+W K+ Sbjct: 437 PELYSRNFGV-ISYKSDVYSFGMLVLEMVSGRRNLDPGI-----DNQHEVYFLEWIYEKV 490 Query: 575 TPGQNKIV 598 GQN ++ Sbjct: 491 FTGQNLLI 498 >01_05_0548 + 23149271-23149568,23149766-23149845,23150137-23150223, 23150421-23150729,23150774-23150899,23151977-23152360, 23152603-23152608 Length = 429 Score = 27.9 bits (59), Expect = 7.2 Identities = 17/78 (21%), Positives = 36/78 (46%), Gaps = 5/78 (6%) Frame = +2 Query: 296 LVTFFDYSQFDATNSVFLTK-----KEIKTSYPHNFKVRQPRLNHKPFSVTIDVXSDIAT 460 L F +S F ++++ + + ++KT ++ ++ PRL + S+ DV + + Sbjct: 64 LAAVFSFSSFTSSSNYVIRECLGSVLDLKTVATIDWSMKTPRLQYYTSSMVDDVFTRLGE 123 Query: 461 DAVIKIFLGPKYNDXGFP 514 D +K + Y G P Sbjct: 124 DIKVKPWAHTVYGKNGIP 141 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,166,284 Number of Sequences: 37544 Number of extensions: 321081 Number of successful extensions: 759 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 759 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -