BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K03 (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 32 0.46 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_43460| Best HMM Match : Keratin_B2 (HMM E-Value=0.68) 29 4.2 SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) 29 4.2 SB_36304| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) 28 7.4 SB_23914| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_57031| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 32.3 bits (70), Expect = 0.34 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +2 Query: 134 ALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFD 313 AL + ALR P ++Y + ++ FK LK YP H + + L+ + D Sbjct: 180 ALRYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEYID 239 Query: 314 YSQ 322 Y Q Sbjct: 240 YGQ 242 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 31.9 bits (69), Expect = 0.46 Identities = 25/97 (25%), Positives = 42/97 (43%) Frame = +3 Query: 96 HLNHSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTLTHSSIT*SLILKRNFISSALKS 275 +L HST T S L T T +++++T + TLTH +IT S I L Sbjct: 26 NLTHSTLTHSNLTHLNLTHSTL-TYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 276 MMLSLRN*SHSLTIANLMPLTVYS*PKKRLRLVTHTT 386 + L+ +HS + + + + +TH+T Sbjct: 85 LTLTYSTLTHSTLTHSTLTHSTLTHSTLTHSTITHST 121 Score = 29.1 bits (62), Expect = 3.2 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 174 SISYITGLWVTLTHSSIT*SLILKRNFISSALKSMMLSLRN*SHS-LTIANLMPLTV 341 ++++ T + +TLTHS++T + N S L L+ N +HS LT + L LT+ Sbjct: 1 TLTHPTLIHLTLTHSNLTHLTLTHSNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTL 57 Score = 29.1 bits (62), Expect = 3.2 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 4/86 (4%) Frame = +3 Query: 63 MKLSLAMCSVQHLNHSTSTPSCPVRLTFTKP---HFETLH-SISYITGLWVTLTHSSIT* 230 + L+ + + L H T T S LT T H H +++++T + TLTHS++T Sbjct: 40 LNLTHSTLTYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTHLTLTYSTLTHSTLTH 99 Query: 231 SLILKRNFISSALKSMMLSLRN*SHS 308 S + S L ++ +HS Sbjct: 100 STLTHSTLTHSTLTHSTITHSTLTHS 125 Score = 29.1 bits (62), Expect = 3.2 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = +3 Query: 60 LMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTLTHSSIT*S 233 L L+L ++ HL +ST T S LT T H +++Y T TLTHS++T S Sbjct: 52 LTHLTLTYSTLTHLTITYSTITHSTLTHLTLT--HL----TLTYSTLTHSTLTHSTLTHS 105 Query: 234 LILKRNFISSALKSMMLSLRN*SH 305 + S + L+ N +H Sbjct: 106 TLTHSTLTHSTITHSTLTHSNLTH 129 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 75 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 167 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_43460| Best HMM Match : Keratin_B2 (HMM E-Value=0.68) Length = 306 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 86 LGAAPKPFDKHTFMPSALDFYQTALRDPAFYQLYNRIVGYINAF 217 +G + + F+P+ L F T+ D FY NR +G IN++ Sbjct: 1 MGVTLRRAKEKRFIPADLSFGITSFYDVYFYSPRNRSLGIINSY 44 >SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) Length = 688 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 478 DLDNGISGNIGLNVDGN 428 ++D G+SGN LNVDG+ Sbjct: 397 NIDTGVSGNFSLNVDGS 413 >SB_36304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 527 ENWHKFYELDWFTHKITPGQNKIVRN 604 + WHK YELD F K + N I+RN Sbjct: 66 KEWHK-YELDKFMEKTSSYHNTILRN 90 >SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/99 (17%), Positives = 44/99 (44%), Gaps = 1/99 (1%) Frame = +2 Query: 320 QFDATNSVFLTKKEIKTSYPHNFKVRQPRLNHKPFSVTIDVXSDIATDAVIKIFLGPKYN 499 + D +SV + + + S + +++ ++ + + I V + + + I Y Sbjct: 273 ELDTGSSVSIIPRNVYESTCKHLELKPAKVKLRTYGSEIIVPMGVVSARTLVITTNAMYV 332 Query: 500 DXGFPITL-EENWHKFYELDWFTHKITPGQNKIVRNSNE 613 G + L +W + ++L+W + K+ G+N + + E Sbjct: 333 VDGPRVALFGRSWLRLFKLEWPSIKLVQGKNTALSDLTE 371 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/99 (17%), Positives = 44/99 (44%), Gaps = 1/99 (1%) Frame = +2 Query: 320 QFDATNSVFLTKKEIKTSYPHNFKVRQPRLNHKPFSVTIDVXSDIATDAVIKIFLGPKYN 499 + D +SV + + + S + +++ ++ + + I V + + + I Y Sbjct: 756 ELDTGSSVSIIPRNVYESTCKHLELKPAKVKLRTYGSEIIVPMGVVSARTLVITTNAMYV 815 Query: 500 DXGFPITL-EENWHKFYELDWFTHKITPGQNKIVRNSNE 613 G + L +W + ++L+W + K+ G+N + + E Sbjct: 816 VDGPRVALFGRSWLRLFKLEWPSIKLVQGKNTALSDLTE 854 >SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) Length = 474 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 251 LHFVGVKINDVVVEKLVTFFDYSQFDATNSV 343 LH G K++D VVE + F + +QF AT+ V Sbjct: 181 LHAQG-KVDDAVVESVREFLEANQFKATSDV 210 >SB_23914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/27 (44%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = -3 Query: 478 DLDNGISGNIGLNVDGNT--ERLVVES 404 ++D G+ GN LN+DG+ E+L+VE+ Sbjct: 340 NIDVGVGGNFTLNMDGSALIEKLLVET 366 >SB_57031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1495 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 520 CDGESXIVVLRSQEDLDNGISGNIG-LNVDGNTERLVVESW 401 C ES ++LR+ ED+ + GN+G LN+ T+ V SW Sbjct: 815 CGAESNELILRTFEDVPSVAPGNVGTLNLTSMTDLRV--SW 853 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,245,192 Number of Sequences: 59808 Number of extensions: 387239 Number of successful extensions: 971 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 964 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -