BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_K02 (610 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 33 0.010 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 24 3.3 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 24 3.3 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 24 3.3 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 24 3.3 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 24 3.3 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 24 3.3 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 24 3.3 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 24 3.3 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 24 3.3 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 24 3.3 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 24 3.3 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 24 3.3 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 24 3.3 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 24 3.3 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 24 3.3 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 24 3.3 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 24 3.3 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 24 3.3 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 24 3.3 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 24 3.3 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 24 3.3 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 24 3.3 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 24 3.3 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 24 3.3 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 24 3.3 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 24 3.3 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 24 3.3 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 24 4.4 AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 prot... 23 7.7 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 7.7 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 7.7 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 32.7 bits (71), Expect = 0.010 Identities = 16/70 (22%), Positives = 25/70 (35%) Frame = +2 Query: 239 VLVEFYAPWCGHCKQLVPIYDKLGEHFEXXXXXXXXXXXXTANELEHTKITSFPTIKLYT 418 V+V+F+A WCG CK + P ++ + I S PT Sbjct: 23 VVVDFFATWCGPCKVIAPKLEEFQNKYADKIVVVKVDVDECEELAAQYNIASMPTFLFIK 82 Query: 419 KDNQVRDYXG 448 + V + G Sbjct: 83 RKEVVGQFSG 92 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 80 IIMFYADWCFACMKAANSFKKLIDTLE 106 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 80 IIMFYADWCFACMKAANSFKKLIDTLE 106 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 82 IIMFYADWCFACMKAANSFKKLIDTLE 108 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 82 IIMFYADWCFACMKAANSFKKLIDTLE 108 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 85 IIMFYADWCFACMKAANSFKKLIDTLE 111 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 85 IIMFYADWCFACMKAANSFKKLIDTLE 111 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 97 IIMFYADWCFACMKAANSFKKLIDTLE 123 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 97 IIMFYADWCFACMKAANSFKKLIDTLE 123 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 79 IIMFYADWCFACMKAANSFKKLIDTLE 105 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 79 IIMFYADWCFACMKAANSFKKLIDTLE 105 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 242 LVEFYAPWCGHCKQLVPIYDKLGEHFE 322 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 2 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 41 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 2 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 41 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 4 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 43 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 4 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 43 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 4 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 43 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 4 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 43 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 2 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 41 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 2 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 41 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 4 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 43 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 4 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 43 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 2 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 41 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 2 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 41 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 2 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 41 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 2 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 41 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 2 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 41 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 2 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 41 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 3 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 42 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 3 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 42 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 422 DNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDVPT 553 DN D +R LA L +ET GA +S+ + +E+V T Sbjct: 1 DNDENDIGEKRRLAFLDLMIETANNGA----NISDEEIKEEVDT 40 >AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 protein. Length = 100 Score = 23.0 bits (47), Expect = 7.7 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +2 Query: 419 KDNQVRDYXGERTLAGLTKFVETDGEGAEPVPTVSEYDEEEDV 547 +D+ +R Y R+ AGL + + G S Y+ +DV Sbjct: 54 RDHALRPYNDYRSWAGLERLTSFEQFGPVGARLASVYEFPDDV 96 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.0 bits (47), Expect = 7.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 187 LDGFSSPVRGQVLAQQVLFQSS 122 LDGF S R Q+ VLF S Sbjct: 254 LDGFRSGFRDQLRGADVLFMQS 275 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.0 bits (47), Expect = 7.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 187 LDGFSSPVRGQVLAQQVLFQSS 122 LDGF S R Q+ VLF S Sbjct: 254 LDGFRSGFRDQLRGADVLFMQS 275 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 543,654 Number of Sequences: 2352 Number of extensions: 10624 Number of successful extensions: 118 Number of sequences better than 10.0: 96 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -