BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J22 (355 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0880 + 32687018-32687060,32687142-32687219,32687323-326875... 28 1.8 08_02_1384 + 26599950-26600033,26600307-26600374,26601000-266010... 26 7.4 04_04_1284 + 32376870-32376874,32376876-32376935,32377166-323773... 26 9.8 >01_06_0880 + 32687018-32687060,32687142-32687219,32687323-32687532, 32687868-32689744 Length = 735 Score = 28.3 bits (60), Expect = 1.8 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 227 TARTKLTSESEFQNKETISIVTKVGLVHK 141 TA +T E NK++ ++V K+ LVHK Sbjct: 130 TASVSITIEDTTSNKDSSTLVEKIKLVHK 158 >08_02_1384 + 26599950-26600033,26600307-26600374,26601000-26601072, 26601299-26601408,26601491-26601595,26601815-26601914, 26601989-26602165 Length = 238 Score = 26.2 bits (55), Expect = 7.4 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = -3 Query: 293 LAELNEAIANPATNPELIHYLETARTKLTSESEFQNKETISIVTK 159 L L EA +L+HY+ TAR L E IS V+K Sbjct: 10 LLRLLEAAPRQQNQAKLVHYVTTARELLEQLGAETTPEGISSVSK 54 >04_04_1284 + 32376870-32376874,32376876-32376935,32377166-32377301, 32377439-32377596,32377791-32377881,32377975-32378094, 32378166-32378234,32378354-32378445,32378578-32378680, 32378761-32378868,32378949-32379011,32379073-32379144, 32379322-32379399,32379478-32379540,32379617-32379680, 32379817-32379902,32380456-32380569,32380760-32380837, 32381068-32381303,32381486-32381576,32381706-32381894, 32382082-32382117 Length = 703 Score = 25.8 bits (54), Expect = 9.8 Identities = 20/67 (29%), Positives = 30/67 (44%) Frame = -3 Query: 353 LFPKNSIKVYVRAMDISTWTLAELNEAIANPATNPELIHYLETARTKLTSESEFQNKETI 174 L +N++K+ + +D L + A L LE RTKL SE++ E Sbjct: 450 LVAENNLKMEILPVDDLDIALHDFVSKDDKMAFYACLQRNLEETRTKLNSEADKFKIEEE 509 Query: 173 SIVTKVG 153 I+ KVG Sbjct: 510 DIIVKVG 516 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,935,707 Number of Sequences: 37544 Number of extensions: 104853 Number of successful extensions: 284 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 284 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 530315984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -