BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J19 (477 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces p... 31 0.12 SPBC4B4.03 |rsc1||RSC complex subunit Rsc1 |Schizosaccharomyces ... 26 3.4 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 25 5.9 SPAC22E12.09c |krp1|krp|kexin|Schizosaccharomyces pombe|chr 1|||... 25 7.9 SPAC20G4.08 ||SPAC4F10.01|sequence orphan|Schizosaccharomyces po... 25 7.9 SPCC16A11.06c |gpi10||pig-B|Schizosaccharomyces pombe|chr 3|||Ma... 25 7.9 SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Sc... 25 7.9 >SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 245 Score = 30.7 bits (66), Expect = 0.12 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -2 Query: 461 TRNPSPRQSSRASLEYLLLPPRSAPTEAPGGLAPRPFCALR-RARPTRYGL 312 ++NP R +SR+ PP+SAP++ + P A + R R R+G+ Sbjct: 191 SKNPQNRSNSRSKQRNKNAPPKSAPSKRKSNILDDPIEAEKARKRAERFGV 241 >SPBC4B4.03 |rsc1||RSC complex subunit Rsc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 803 Score = 25.8 bits (54), Expect = 3.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 409 YYHQDLHRRRLQAGSRPDPSALSAAHVLL 323 Y +DL RR+LQ S+P S + A V++ Sbjct: 191 YKSEDLKRRKLQPSSKPLSSLEARAKVIM 219 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 25.0 bits (52), Expect = 5.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 378 SRRARAQTLLRSPPRTSYSLRLNDTRVSASH 286 SRR + T+ SP RT+Y N+ + SA++ Sbjct: 84 SRRVASYTVQSSPSRTTYRQLPNEPQNSAAY 114 >SPAC22E12.09c |krp1|krp|kexin|Schizosaccharomyces pombe|chr 1|||Manual Length = 709 Score = 24.6 bits (51), Expect = 7.9 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -1 Query: 396 ICTDGGSRRARAQTLLR--SPPRTSYSLRLNDTRVSASHVPVTVV 268 I ++ S + TLL S TSY++ T S SH+P+ V Sbjct: 610 IYSEPNSDLTNSSTLLSPTSTSFTSYTVSATATPTSTSHIPIPTV 654 >SPAC20G4.08 ||SPAC4F10.01|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1076 Score = 24.6 bits (51), Expect = 7.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 361 GASPPGASVGADLGGSSKYSSEALED*R 444 GA P G + GAD+ S S+EA + R Sbjct: 95 GAKPSGTASGADVKRSDSESTEATSNER 122 >SPCC16A11.06c |gpi10||pig-B|Schizosaccharomyces pombe|chr 3|||Manual Length = 506 Score = 24.6 bits (51), Expect = 7.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 115 LGALTLRLVHPTAPVLLTKIG 53 +G LR V+P +P+LLT G Sbjct: 323 IGHKELRFVYPISPILLTLAG 343 >SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Schizosaccharomyces pombe|chr 1|||Manual Length = 380 Score = 24.6 bits (51), Expect = 7.9 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 130 SHERFLGALTLRLVHPTAPVLLT 62 +HE + AL + L +P P++LT Sbjct: 4 NHEVYKDALPISLAYPLPPIILT 26 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,064,200 Number of Sequences: 5004 Number of extensions: 40633 Number of successful extensions: 112 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 184476110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -