BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J19 (477 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 25 1.8 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 24 2.4 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 23 4.1 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 23 4.1 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 23 5.5 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 23 5.5 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 23 5.5 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 23 5.5 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 23 5.5 AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein prot... 23 5.5 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 23 5.5 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 7.2 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 7.2 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 7.2 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 22 9.6 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 22 9.6 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 24.6 bits (51), Expect = 1.8 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -3 Query: 457 ETLLHVSPPGPRWSICYYHQDLHRRRLQAGSRPDPSALSAAHVLLVTA 314 +++ ++S P WSI Y+ +D+ +QA + + +LVTA Sbjct: 210 QSVRNLSRPITGWSIKYFSKDIFEVMMQAAVDTEVTTSEDLMRILVTA 257 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 24.2 bits (50), Expect = 2.4 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -2 Query: 458 RNPSPRQSSRASLEYLLLPPRS-APTEAPGGLAP 360 RN ++ RAS ++PPRS A T G + P Sbjct: 225 RNQHEQEQPRASTSRAVMPPRSEALTAVRGDVVP 258 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 4.1 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 342 PPRTSYSLRLNDTRVSASHVPVT 274 PP T+ ++ ++ T + +HVP T Sbjct: 213 PPTTTTTVWIDPTATTTTHVPTT 235 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 4.1 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 342 PPRTSYSLRLNDTRVSASHVPVT 274 PP T+ ++ ++ T + +HVP T Sbjct: 214 PPTTTTTVWIDPTATTTTHVPTT 236 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 23.0 bits (47), Expect = 5.5 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 7/45 (15%) Frame = -1 Query: 459 AKPFSTSVLQGLAGVFATTTKICT-------DGGSRRARAQTLLR 346 A PF T ++ G AGV A T ++ + D G RA T L+ Sbjct: 58 ALPFCTHLMYGYAGVNAETYRLRSLNEDLDLDSGKSHFRAVTTLK 102 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 5.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 141 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 230 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 5.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 141 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 230 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 5.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 141 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 230 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 5.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 141 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 230 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein protein. Length = 385 Score = 23.0 bits (47), Expect = 5.5 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 285 VPVTVVYRQNASAPSIFRAGCFGR*VVAHS 196 +P+ V+ ++N +AP+ + A C R H+ Sbjct: 36 IPLEVLEQENGTAPADWSASCTQRRTEDHA 65 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.0 bits (47), Expect = 5.5 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -2 Query: 458 RNPSPRQSSRASLEYLLLPPRS-APTEAPGGLAP 360 RN ++ RAS + ++ PRS A T G + P Sbjct: 201 RNQQEQEQPRASTSHAVMLPRSEASTAVRGDVVP 234 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 22.6 bits (46), Expect = 7.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 146 WSLMTAGRWPWKSESAKE 199 WS+ AG W W S SA E Sbjct: 410 WSVC-AGNWMWVSSSAFE 426 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 22.6 bits (46), Expect = 7.2 Identities = 10/31 (32%), Positives = 11/31 (35%) Frame = +2 Query: 134 HERRWSLMTAGRWPWKSESAKECATTHLPKQ 226 H W + WP ES C T KQ Sbjct: 1189 HGPDWLVKDPKHWPKNIESGNTCETAKEEKQ 1219 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 22.6 bits (46), Expect = 7.2 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 342 PPRTSYSLRLNDTRVSASHVPVT 274 PP T+ ++ ++ T + +HVP T Sbjct: 214 PPTTTTTVWIDPTATTTTHVPPT 236 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 22.2 bits (45), Expect = 9.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 364 ASPPGASVGADLGGSS 411 A PP +G D+GG+S Sbjct: 317 AGPPPPLIGFDMGGTS 332 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 22.2 bits (45), Expect = 9.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 364 ASPPGASVGADLGGSS 411 A PP +G D+GG+S Sbjct: 317 AGPPPPLIGFDMGGTS 332 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,963 Number of Sequences: 2352 Number of extensions: 11318 Number of successful extensions: 307 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 307 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 42095889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -