BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J19 (477 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ427109-1|ABD72605.1| 1048|Homo sapiens OTUD4: OTU domain conta... 30 3.6 BC118653-1|AAI18654.1| 1049|Homo sapiens OTU domain containing 4... 30 3.6 BC118572-1|AAI18573.1| 1049|Homo sapiens OTU domain containing 4... 30 3.6 AL445068-2|CAI22520.1| 366|Homo sapiens protein ( Human DNA seq... 30 3.6 AL050350-5|CAI42513.1| 366|Homo sapiens protein ( Human DNA seq... 30 3.6 BC112034-1|AAI12035.1| 157|Homo sapiens hypothetical protein LO... 30 4.8 BC093711-1|AAH93711.1| 157|Homo sapiens hypothetical protein LO... 30 4.8 AL133561-1|CAB63715.1| 580|Homo sapiens hypothetical protein pr... 29 6.3 AF282168-1|AAG03039.1| 437|Homo sapiens DRC3 protein. 29 6.3 AF282167-1|AAG03038.1| 437|Homo sapiens DRC3 protein. 29 6.3 DQ847413-1|ABI75345.1| 209|Homo sapiens fibroblast growth facto... 29 8.3 CR457090-1|CAG33371.1| 619|Homo sapiens PIAS3 protein. 29 8.3 BT007036-1|AAP35684.1| 619|Homo sapiens protein inhibitor of ac... 29 8.3 BC030556-1|AAH30556.1| 619|Homo sapiens protein inhibitor of ac... 29 8.3 BC018404-1|AAH18404.1| 209|Homo sapiens fibroblast growth facto... 29 8.3 BC001154-1|AAH01154.1| 619|Homo sapiens protein inhibitor of ac... 29 8.3 AB021868-1|BAA78533.1| 619|Homo sapiens protein inhibitor of ac... 29 8.3 >DQ427109-1|ABD72605.1| 1048|Homo sapiens OTUD4: OTU domain containing 4 protein. Length = 1048 Score = 30.3 bits (65), Expect = 3.6 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 48 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 143 +GP+LV G T +++KAP SW+T+ G Sbjct: 246 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 276 >BC118653-1|AAI18654.1| 1049|Homo sapiens OTU domain containing 4 protein. Length = 1049 Score = 30.3 bits (65), Expect = 3.6 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 48 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 143 +GP+LV G T +++KAP SW+T+ G Sbjct: 247 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 277 >BC118572-1|AAI18573.1| 1049|Homo sapiens OTU domain containing 4 protein. Length = 1049 Score = 30.3 bits (65), Expect = 3.6 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 48 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 143 +GP+LV G T +++KAP SW+T+ G Sbjct: 247 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 277 >AL445068-2|CAI22520.1| 366|Homo sapiens protein ( Human DNA sequence from clone RP1-71D21 on chromosome 6. ). Length = 366 Score = 30.3 bits (65), Expect = 3.6 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -2 Query: 446 PRQSSRASLEYLLLPPRSAPTEAPGGLAPRPFCALRRARPTRYG 315 PR +SR + Y+ R AP G P P C R RP R G Sbjct: 65 PRGASRRQVTYVR-SGRRAPPGGGGSGTPEPGCCAPRGRPRRKG 107 >AL050350-5|CAI42513.1| 366|Homo sapiens protein ( Human DNA sequence from clone RP1-261K5 on chromosome 6q21-22.1 Contains the 3' end of the SLC22A16 gene for solute carrier family ). Length = 366 Score = 30.3 bits (65), Expect = 3.6 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -2 Query: 446 PRQSSRASLEYLLLPPRSAPTEAPGGLAPRPFCALRRARPTRYG 315 PR +SR + Y+ R AP G P P C R RP R G Sbjct: 65 PRGASRRQVTYVR-SGRRAPPGGGGSGTPEPGCCAPRGRPRRKG 107 >BC112034-1|AAI12035.1| 157|Homo sapiens hypothetical protein LOC284009 protein. Length = 157 Score = 29.9 bits (64), Expect = 4.8 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -3 Query: 466 CSRETLLHVSPPGPRWSICYYHQDLHR-RRLQAGSRPDP 353 C R ++H+ G RW + HR RR GSRP P Sbjct: 40 CGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVP 78 >BC093711-1|AAH93711.1| 157|Homo sapiens hypothetical protein LOC284009 protein. Length = 157 Score = 29.9 bits (64), Expect = 4.8 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -3 Query: 466 CSRETLLHVSPPGPRWSICYYHQDLHR-RRLQAGSRPDP 353 C R ++H+ G RW + HR RR GSRP P Sbjct: 40 CGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVP 78 >AL133561-1|CAB63715.1| 580|Homo sapiens hypothetical protein protein. Length = 580 Score = 29.5 bits (63), Expect = 6.3 Identities = 23/51 (45%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -2 Query: 461 TRNPSP----RQSSRASLEYLLLPPRSAPTEAPGGLAPRPFCALRRARPTR 321 TR+PS R SRASL PPR++PT P +PR RA PTR Sbjct: 168 TRSPSTASLTRTPSRASLTRW--PPRASPTRTPPRESPR---MSHRASPTR 213 >AF282168-1|AAG03039.1| 437|Homo sapiens DRC3 protein. Length = 437 Score = 29.5 bits (63), Expect = 6.3 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -2 Query: 461 TRNPSPRQSSRASLEYLLLPPRSAPTEAPGGLAPRPF 351 ++ P+PR S A PPRSAP P LAP P+ Sbjct: 399 SQGPAPRNRSSARAR---TPPRSAPGCRPRALAPGPW 432 >AF282167-1|AAG03038.1| 437|Homo sapiens DRC3 protein. Length = 437 Score = 29.5 bits (63), Expect = 6.3 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -2 Query: 461 TRNPSPRQSSRASLEYLLLPPRSAPTEAPGGLAPRPF 351 ++ P+PR S A PPRSAP P LAP P+ Sbjct: 399 SQGPAPRNRSSARAR---TPPRSAPGCRPRALAPGPW 432 >DQ847413-1|ABI75345.1| 209|Homo sapiens fibroblast growth factor 21 protein. Length = 209 Score = 29.1 bits (62), Expect = 8.3 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = -2 Query: 458 RNPSPRQSSRASLEYLLLPPRSAPTEAPGGLAPRP 354 R+P+PR +R L LPP AP E PG LAP+P Sbjct: 154 RDPAPRGPARF-LPLPGLPP--APPEPPGILAPQP 185 >CR457090-1|CAG33371.1| 619|Homo sapiens PIAS3 protein. Length = 619 Score = 29.1 bits (62), Expect = 8.3 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 458 RNPSPRQSSRAS-LEYLLLPPRSAPTEAPGGLAPRP 354 R PR++ S L L LPP ++P +PG LAP P Sbjct: 53 RRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIP 88 >BT007036-1|AAP35684.1| 619|Homo sapiens protein inhibitor of activated STAT3 protein. Length = 619 Score = 29.1 bits (62), Expect = 8.3 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 458 RNPSPRQSSRAS-LEYLLLPPRSAPTEAPGGLAPRP 354 R PR++ S L L LPP ++P +PG LAP P Sbjct: 53 RRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIP 88 >BC030556-1|AAH30556.1| 619|Homo sapiens protein inhibitor of activated STAT, 3 protein. Length = 619 Score = 29.1 bits (62), Expect = 8.3 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 458 RNPSPRQSSRAS-LEYLLLPPRSAPTEAPGGLAPRP 354 R PR++ S L L LPP ++P +PG LAP P Sbjct: 53 RRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIP 88 >BC018404-1|AAH18404.1| 209|Homo sapiens fibroblast growth factor 21 protein. Length = 209 Score = 29.1 bits (62), Expect = 8.3 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = -2 Query: 458 RNPSPRQSSRASLEYLLLPPRSAPTEAPGGLAPRP 354 R+P+PR +R L LPP AP E PG LAP+P Sbjct: 154 RDPAPRGPARF-LPLPGLPP--APPEPPGILAPQP 185 >BC001154-1|AAH01154.1| 619|Homo sapiens protein inhibitor of activated STAT, 3 protein. Length = 619 Score = 29.1 bits (62), Expect = 8.3 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 458 RNPSPRQSSRAS-LEYLLLPPRSAPTEAPGGLAPRP 354 R PR++ S L L LPP ++P +PG LAP P Sbjct: 53 RRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIP 88 >AB021868-1|BAA78533.1| 619|Homo sapiens protein inhibitor of activatied STAT3 protein. Length = 619 Score = 29.1 bits (62), Expect = 8.3 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 458 RNPSPRQSSRAS-LEYLLLPPRSAPTEAPGGLAPRP 354 R PR++ S L L LPP ++P +PG LAP P Sbjct: 53 RRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIP 88 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,977,420 Number of Sequences: 237096 Number of extensions: 1778869 Number of successful extensions: 5267 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 4877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5265 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4213781852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -