BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J18 (549 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 23 1.3 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 1.8 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 7.1 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 7.1 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 9.4 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 23.4 bits (48), Expect = 1.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 524 NGKTYANKCSLECTQKIIPSL 462 NG+ NKC C ++ PS+ Sbjct: 51 NGEVAVNKCEGSCKSQVQPSV 71 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 58 YVILIYLNVFVI*HFY 105 ++IL YL+VFVI +Y Sbjct: 324 FIILFYLSVFVILVYY 339 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.0 bits (42), Expect = 7.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 536 VCGSNGKTYANKCSLECTQKII 471 V G N YA+ +E +QK++ Sbjct: 220 VTGQNAPLYASSIDVEGSQKLL 241 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +1 Query: 361 TPSLPQTGPFSRVHIHGCKLASLAPWHSPSCS 456 +P + P + HG +SL SPS S Sbjct: 242 SPQMQSYRPTGNITPHGSNTSSLITTPSPSAS 273 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 188 YYFKHSPFSSHL*QYTCSNGFSF 256 Y+ H+PF+ ++ CS+ SF Sbjct: 492 YHGFHNPFTCNMCGVECSDKVSF 514 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,793 Number of Sequences: 336 Number of extensions: 2769 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -