BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J11 (501 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1718.04 |||glycerol-3-phosphate O-acyltransferase |Schizosac... 27 2.1 SPAC4F10.10c |||mannosyltransferase complex subunit, Anp family ... 25 4.8 >SPBC1718.04 |||glycerol-3-phosphate O-acyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 675 Score = 26.6 bits (56), Expect = 2.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 364 PDAGHRDLPTSSSHYHPHIFK 426 PD G + LP +++HPH F+ Sbjct: 236 PDCGLQLLPCGMNYFHPHRFR 256 >SPAC4F10.10c |||mannosyltransferase complex subunit, Anp family |Schizosaccharomyces pombe|chr 1|||Manual Length = 337 Score = 25.4 bits (53), Expect = 4.8 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +2 Query: 131 VTFIIYFNNNDINSRAMVKTE-CSVRPVKAYIMSDLLKRFDYETTNDFVQIAISIAGFY 304 +TFI Y +NS A V+ E + Y M+ + + D + V I IA FY Sbjct: 20 ITFIYYLFTPSVNSNAKVQIENRGGNSYEIYDMNKITESSDPIRNKEEVLILTPIARFY 78 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,828,981 Number of Sequences: 5004 Number of extensions: 34711 Number of successful extensions: 87 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -