BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J02 (619 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0824 + 20821724-20822137,20822457-20822543,20822729-208228... 33 0.18 01_05_0495 + 22705697-22705765,22705903-22706025,22708429-227085... 29 2.2 08_02_1557 + 27867977-27869134 29 3.0 01_07_0131 + 41292800-41293400,41293522-41293649,41293759-412940... 28 5.2 08_01_0303 + 2493388-2493954 28 6.8 08_01_0064 + 444888-444959,445073-445277,445736-445901,446029-44... 28 6.8 01_06_0240 + 27794741-27795466 28 6.8 11_08_0023 + 27741775-27742475,27744163-27744413,27744557-277447... 27 9.0 11_05_0096 - 19029632-19029937,19030376-19031197 27 9.0 07_03_1361 - 25998873-25999223,25999311-25999461,25999546-259997... 27 9.0 04_04_0236 + 23825368-23825763,23826229-23828667 27 9.0 02_05_0232 + 27041793-27042087,27042822-27042943,27043098-270432... 27 9.0 02_03_0143 + 15685242-15686298,15688167-15688265,15688998-156890... 27 9.0 >10_08_0824 + 20821724-20822137,20822457-20822543,20822729-20822829, 20822917-20822967,20823616-20823790,20823878-20824192, 20824504-20824707,20824799-20825314,20825400-20825609, 20826092-20826280,20827254-20827405,20827685-20827837, 20827925-20828006,20828086-20828475 Length = 1012 Score = 33.1 bits (72), Expect = 0.18 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 222 FETTQSNEQSYKDLVMPLITQLVDNLKSKQITDIKIYL-AGHTSKYPYPILYDTDLKLKS 398 FET + E S D L+T+++DNL + + Y + TS Y YP L D + L Sbjct: 540 FETKAALENSSSDDDSQLLTRIIDNLVDESHESNQTYSDSNDTSLYNYPSLSDWN-DLNE 598 Query: 399 SKLHFDDKERYE 434 ++ F+D ER E Sbjct: 599 VEI-FEDIERRE 609 >01_05_0495 + 22705697-22705765,22705903-22706025,22708429-22708586, 22709162-22709206,22709367-22709445,22709522-22709595, 22709703-22709809,22711116-22711301,22711882-22711920, 22712020-22712086,22712207-22712281,22713113-22713347, 22713425-22713755,22714530-22714710,22714810-22714950, 22715041-22715302,22715503-22715892,22717179-22717735, 22718421-22718557,22718672-22718853,22718959-22719339, 22719420-22719545,22719635-22719700,22720056-22721839, 22721914-22722193,22722386-22722616,22723067-22723588, 22723683-22723815,22723937-22724193 Length = 2405 Score = 29.5 bits (63), Expect = 2.2 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 8/74 (10%) Frame = +3 Query: 387 KLKSSKLHFDDKERYERM-PFVKTGCDTFDKYEKNVIDFMD---TLKIKLGL----SNIV 542 +LKS KLH +D+E ++ PFVK + ++V+ L IKL L N Sbjct: 1739 RLKSIKLHKNDEELLSKLDPFVKLLAECLSSKHESVLSISFRCLALLIKLPLPSLKDNAN 1798 Query: 543 LSEKSLLDLPFRAG 584 L + L+D+ RAG Sbjct: 1799 LIKNVLMDIAQRAG 1812 >08_02_1557 + 27867977-27869134 Length = 385 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -1 Query: 97 VRASAAYPLARSQAWCKSLAASVP 26 V AS+AYP Q+ CKS AAS P Sbjct: 218 VAASSAYPYRARQSSCKSSAASSP 241 >01_07_0131 + 41292800-41293400,41293522-41293649,41293759-41294019, 41294154-41294416,41294507-41294831 Length = 525 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 406 YISTTKSATSVCLLSKLDVIHSTNMKRTLSTLW--IHSK*NLVCP 534 YIS+T T V L LD +H++ +K LW H NL+ P Sbjct: 341 YISSTLFYTDVTYLEFLDRVHTSELKLRAQGLWEVPHPWLNLLIP 385 >08_01_0303 + 2493388-2493954 Length = 188 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +3 Query: 9 CIHAVSGTDAAKDLHQACDLARGYAALALTGLLPAVLPDACVRC 140 C HA+S AA +LH+ C R + L T L A VRC Sbjct: 15 CHHAISRRSAAVELHR-CSRRRRPSPLTTTVALTRRRSPAAVRC 57 >08_01_0064 + 444888-444959,445073-445277,445736-445901,446029-446251, 446982-447058,447370-447557,447845-447942,448202-448335, 448421-448555,448832-448960,449263-449632,449897-450018, 450155-450274,450396-450626,450706-450894,450978-451089, 451193-451438 Length = 938 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 336 AGHTSKYPYPILYDTDLKLKSSKLHFDD-KERYERMPFVKTGCDTFDKYEKNVI 494 AG S P I+ D +++KLHFDD +RY + TF+K + ++ Sbjct: 300 AGRLSPKPDIIVQRYDPTYEATKLHFDDVAQRYGHPIIILNLTKTFEKRPREMM 353 >01_06_0240 + 27794741-27795466 Length = 241 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +3 Query: 105 LPAVLPDACVRCTDADKPHAIGDV 176 +PA P A VRCT A KP A G + Sbjct: 24 IPAATPSAIVRCTAAPKP-ATGSI 46 >11_08_0023 + 27741775-27742475,27744163-27744413,27744557-27744715, 27744976-27745409,27745537-27746076 Length = 694 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/45 (24%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 563 QKRLFTQNNIGQT-KFYFECIHKVDNVLFIFVECITSSFDKRHTL 432 +++++ Q+ + T Y C+ +D + + V C+ + DKR T+ Sbjct: 631 RRKMYDQDMLSSTDSLYPYCMECLDRMAAVAVRCLKNKVDKRPTM 675 >11_05_0096 - 19029632-19029937,19030376-19031197 Length = 375 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 42 KDLHQACDLARGYAALALTGLLPAVLPDACVRCTDADKPHAIGD 173 + L D+ G+ A+A + A PD ++CT D PH + D Sbjct: 206 RGLRSLVDVGGGHGAVAKA--IAAAFPD--IKCTVMDLPHVVAD 245 >07_03_1361 - 25998873-25999223,25999311-25999461,25999546-25999783, 25999898-26000108,26000210-26000340,26000909-26001037, 26001329-26002130 Length = 670 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -1 Query: 154 LSASVQRTQASGSTAGSSPVRASAAYPLARSQAWC 50 L+A+ T A+ G+ + YP+ S AWC Sbjct: 165 LNATADYTAAAARRFGTGEISFDPTYPVIYSMAWC 199 >04_04_0236 + 23825368-23825763,23826229-23828667 Length = 944 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/54 (27%), Positives = 29/54 (53%) Frame = +3 Query: 330 YLAGHTSKYPYPILYDTDLKLKSSKLHFDDKERYERMPFVKTGCDTFDKYEKNV 491 Y+ T+ + +DT +KL+S + +DD +++ P V +G F++ NV Sbjct: 588 YITPETTIKTFIEQFDTAMKLRSDREAYDDFRSFQQRPQVLSGL-LFEEQFANV 640 >02_05_0232 + 27041793-27042087,27042822-27042943,27043098-27043219, 27043601-27043705,27043828-27044257,27044356-27044517, 27044565-27045260,27045349-27046128,27046441-27046654, 27047621-27047981,27047993-27048140,27048276-27048419, 27048784-27048888,27049749-27049794,27050089-27050255, 27050338-27050490,27050654-27050950,27051053-27051220, 27051298-27051363,27051451-27051927,27052031-27052768, 27052935-27053120 Length = 1993 Score = 27.5 bits (58), Expect = 9.0 Identities = 38/191 (19%), Positives = 81/191 (42%), Gaps = 7/191 (3%) Frame = +3 Query: 3 QACIHAVSGTDAAKDLHQACDLARGYAALALTGLLPAVLPDACVRCTDADKPHAIGDVYQ 182 ++ +H+ +D+ ACD + L + +L +AC R + K G+ Sbjct: 1278 RSVMHSPQESDSVNFSSPACDPQQEEEEPNLDEDMHDILNEACTRA-ELLKKEVDGE--S 1334 Query: 183 LKVPNKQADIVVSFETTQSNEQSYKDLVMPLITQLVDNLKSKQITDIKIYLAGHTSKYPY 362 K + D++++ + Q +E+SY V + + ++Q +I H + Y Sbjct: 1335 SKRRKAEMDLLIALQRVQESEKSYLQEVNQ--RKETERTLARQRLEIDEMKRRHNTLYDE 1392 Query: 363 PILYDTD-----LKLKSSKLHFDDKERYERMP--FVKTGCDTFDKYEKNVIDFMDTLKIK 521 L DT L+ S++ K+ + + F++ C+ K++K +D + L+ Sbjct: 1393 --LQDTKKQKLLLEQHISEIKSAAKDYVQEITEYFIQESCEEAKKFQKIKMDLLAMLQRV 1450 Query: 522 LGLSNIVLSEK 554 + N+ +EK Sbjct: 1451 KDVENLNRNEK 1461 >02_03_0143 + 15685242-15686298,15688167-15688265,15688998-15689072, 15689309-15689364,15689786-15689875 Length = 458 Score = 27.5 bits (58), Expect = 9.0 Identities = 32/129 (24%), Positives = 66/129 (51%), Gaps = 3/129 (2%) Frame = +3 Query: 171 DVYQLKV-PNKQADIVVSFETTQSNEQSYKDLVMPLITQLVDNLKSKQITDIKIYLAGHT 347 D Y+ + PN Q+D +S T + ++L + V+ ++K+ T+ +LA Sbjct: 184 DDYRCSILPNHQSDFSLSSPDTLTLITRDENLAVAD----VEEWRAKEYTEK--WLAESE 237 Query: 348 SKYPYPILYDTDLKLKSSKLHFDDK-ERYERMPFVKTGCDTFDKYEKNVIDFMDTLKIKL 524 +KY +PI + T K++ F K ++R+P+ K ++K E + I ++ L+ ++ Sbjct: 238 TKYAFPINFPTGFKIEKG---FRGKLGNWQRLPYTK----AYEKNELHPIRNIERLEKRI 290 Query: 525 -GLSNIVLS 548 G+ + +LS Sbjct: 291 VGILHELLS 299 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,901,616 Number of Sequences: 37544 Number of extensions: 298877 Number of successful extensions: 911 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -