BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J01 (666 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 44 1e-06 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 23 3.5 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 4.6 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 4.6 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 4.6 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 4.6 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 6.0 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 44.0 bits (99), Expect = 1e-06 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 6/116 (5%) Frame = +1 Query: 298 VIESLGHFDALVNNAAVAVCEPFLECSPSNFDKTFDINVKAVLNISQIVARKMVENK-TH 474 V ++LG D L+NNA + + ++ K FDIN+ + + Q V + M + + Sbjct: 78 VEKNLGAIDILINNATINIDVTLQNDEVLDWKKIFDINLLGLTCMIQEVLKLMKKKGINN 137 Query: 475 GAIVNISSQASKAAL---KDHAIYSASKAALDALTRAMALELG--PYGIRVNAVNP 627 G IVNI+ + L ++ Y ASK AL LT + EL I+V +++P Sbjct: 138 GIIVNINDASGLNLLPMNRNRPAYLASKCALTTLTDCLRSELAQCESNIKVISISP 193 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 22.6 bits (46), Expect = 3.5 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +3 Query: 552 CLGCLNSCH 578 CLGC +SCH Sbjct: 36 CLGCGDSCH 44 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 596 GPSSKAMARVKASKAALEAL 537 GPS K +A+ ASKAAL L Sbjct: 197 GPSKK-LAKAAASKAALAKL 215 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +1 Query: 532 IYSASKAALDALTRAMALELGPYGIRVNAVNPYC 633 I SASK A+D R L+ G VN P C Sbjct: 121 IVSASKLAIDKCDRLWVLDSG----LVNNTQPMC 150 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +1 Query: 532 IYSASKAALDALTRAMALELGPYGIRVNAVNPYC 633 I SASK A+D R L+ G VN P C Sbjct: 121 IVSASKLAIDKCDRLWVLDSG----LVNNTQPMC 150 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +1 Query: 532 IYSASKAALDALTRAMALELGPYGIRVNAVNPYC 633 I SASK A+D R L+ G VN P C Sbjct: 121 IVSASKLAIDKCDRLWVLDSG----LVNNTQPMC 150 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = -3 Query: 280 SRQHQRQQYQ*KGIHSGGSPSEIWSE 203 + Q + QYQ +H G + +W++ Sbjct: 278 TEQFVKSQYQANNVHYQGKENILWTQ 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,108 Number of Sequences: 438 Number of extensions: 3671 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -