BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_I22 (479 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 5.9 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 5.9 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 21 7.8 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 21 7.8 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.0 bits (42), Expect = 5.9 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -1 Query: 344 YPRSWLCAFSFRLYIIANNRPIILHVLVHIEVQLP 240 YP++++ ++ F L + NN+ H V LP Sbjct: 38 YPQNYINSYLFSLSLAQNNQLFTHHKAPIRPVALP 72 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.0 bits (42), Expect = 5.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 62 LGLLSFLGHHSILEH 18 +GL LG H+ +EH Sbjct: 352 MGLSPILGRHNTIEH 366 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 20.6 bits (41), Expect = 7.8 Identities = 6/19 (31%), Positives = 10/19 (52%) Frame = +1 Query: 160 WPTWPTRCTMRHYRLLNWY 216 + TW + Y L++WY Sbjct: 150 YSTWSKKSKQVEYFLIHWY 168 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 20.6 bits (41), Expect = 7.8 Identities = 6/19 (31%), Positives = 10/19 (52%) Frame = +1 Query: 160 WPTWPTRCTMRHYRLLNWY 216 + TW + Y L++WY Sbjct: 150 YSTWSKKSKQVEYFLIHWY 168 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,638 Number of Sequences: 336 Number of extensions: 2286 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -