BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_I21 (556 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.68 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.68 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.68 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +3 Query: 207 TWSTSTVKAAASTQKTL-ERGRSSISACTLTLVPSTRDSEITSI 335 T STS+ + S QK+L RGRSS S+ TL+P +E T + Sbjct: 1822 TSSTSSDISPMSEQKSLPRRGRSSRSSLR-TLLPPISVAETTFV 1864 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.68 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +3 Query: 207 TWSTSTVKAAASTQKTL-ERGRSSISACTLTLVPSTRDSEITSI 335 T STS+ + S QK+L RGRSS S+ TL+P +E T + Sbjct: 1818 TSSTSSDISPMSEQKSLPRRGRSSRSSLR-TLLPPISVAETTFV 1860 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,326 Number of Sequences: 438 Number of extensions: 2195 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -