BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_I15 (494 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding pr... 24 2.5 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 4.3 AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 23 5.7 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 5.7 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 5.7 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 23 7.6 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.6 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 22 10.0 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 22 10.0 >AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding protein AgamOBP10 protein. Length = 131 Score = 24.2 bits (50), Expect = 2.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 238 NCSSAFRFPLRSPSFSKVFNC 176 +CS + L SPSFS ++ C Sbjct: 42 HCSLSLSLSLLSPSFSPIWQC 62 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.4 bits (48), Expect = 4.3 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -3 Query: 267 LNHRYLSHIGTVHPHLDFPLGVHLSL 190 L+H + H +H HL P H L Sbjct: 348 LHHHHPGHHAALHAHLGVPTSQHHQL 373 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 23.0 bits (47), Expect = 5.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -2 Query: 112 YPTEANNIAHDLPISPLPTIPTFSD 38 Y +E++N HD+ + + P F+D Sbjct: 239 YDSESSNQQHDIALIRIEQTPPFTD 263 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 5.7 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -2 Query: 175 TLISAIASVICFSTTSNKVTWYPTEANNIAHDLPISPLPTIPTFSDLNLEAMTT 14 T I+ A + S+T+N V Y TE+ D P + + + +L+A+TT Sbjct: 153 TGIACSAKIASHSSTNNSVLPYITESPTDLTDAPTTS-NMAASGDETDLDAITT 205 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.0 bits (47), Expect = 5.7 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -2 Query: 175 TLISAIASVICFSTTSNKVTWYPTEANNIAHDLPISPLPTIPTFSDLNLEAMTT 14 T I+ A + S+T+N V Y TE+ D P + + + +L+A+TT Sbjct: 154 TGIACSAKIASHSSTNNSVLPYITESPTDLTDAPTTS-NMAASGDETDLDAITT 206 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +1 Query: 316 IWNSKRKYSKIWTMSSMTTLPYRV 387 I+ + RKY + + + T PYR+ Sbjct: 371 IYETLRKYPPVAILERIVTKPYRI 394 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +3 Query: 291 FVQECVPENLELKKKVFQNLDNVVDDN 371 F+ + +N +++KVF + NVV D+ Sbjct: 19 FLLHSLAQNPTIQEKVFDEVRNVVGDD 45 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 22.2 bits (45), Expect = 10.0 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 346 IWTMSSMTTLPYRVQLVQH 402 IW+ + M T+PY + + H Sbjct: 217 IWSFAIMVTMPYGLYMKLH 235 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 10.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 86 P*SPDQSTPNNSNFFRFKLGSHDD 15 P +P + P+N +FR S DD Sbjct: 417 PLTPGGTLPHNPTYFRTVYSSSDD 440 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,904 Number of Sequences: 2352 Number of extensions: 10604 Number of successful extensions: 33 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43977336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -