BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_I14 (589 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0140 + 12700740-12700935,12701082-12701515 28 6.3 05_01_0033 + 220125-220190,220274-224445,224863-224949,225048-22... 27 8.4 03_03_0243 - 15769102-15769106,15769820-15769950,15770025-15770338 27 8.4 01_06_1608 - 38612754-38616947,38617030-38617095 27 8.4 >09_03_0140 + 12700740-12700935,12701082-12701515 Length = 209 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 491 IPLRRRSAQRRAATWPSSIVKQK 423 +P RRR QRR A +S+V+Q+ Sbjct: 104 LPCRRRGGQRRVAVVEASVVRQR 126 >05_01_0033 + 220125-220190,220274-224445,224863-224949,225048-225084, 225296-225356,225666-226918 Length = 1891 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 519 YKFHSVGRPYSVAAAICSAEGGHLAII 439 Y F+ G P +AA +CS +G HLA++ Sbjct: 1349 YPFNPNGSPLGIAA-LCSPDGRHLAMM 1374 >03_03_0243 - 15769102-15769106,15769820-15769950,15770025-15770338 Length = 149 Score = 27.5 bits (58), Expect = 8.4 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +1 Query: 355 YNIKRDGEGLSGMLCEQVPQDLGFCFTIDDGQVAALR*ADRRRNGIRSSYAMK-LVTLVS 531 +N DG +SG+ + + GF F+ + AL AD+ RNG + ++ LVT Sbjct: 37 FNTNNDGR-ISGVELREAIRSKGFGFSAWWKSIVALHQADKDRNGYIDEFEIENLVTFAQ 95 Query: 532 PLV 540 ++ Sbjct: 96 KVL 98 >01_06_1608 - 38612754-38616947,38617030-38617095 Length = 1419 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 519 YKFHSVGRPYSVAAAICSAEGGHLAII 439 Y F+ G P +AA +CS +G HLA++ Sbjct: 1353 YPFNPNGSPLGIAA-LCSPDGRHLAMM 1378 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,226,270 Number of Sequences: 37544 Number of extensions: 282921 Number of successful extensions: 705 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -