BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_I13 (412 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 0.58 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 1.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 1.8 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 4.1 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 4.1 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 24.2 bits (50), Expect = 0.58 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 36 LTIYQKVESVNNIFSFFYHLTPFCNTIWCFLLKSCFTV 149 +TI +K S ++ F L PF NT+W ++ S V Sbjct: 544 ITILEKKPSRSSTLVSF--LQPFSNTLWILVMVSVHVV 579 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.6 bits (46), Expect = 1.8 Identities = 11/39 (28%), Positives = 16/39 (41%) Frame = -1 Query: 358 SGTSRVQDNTHRAPNSKDSHINHNPRSRMKNTGPFFCCT 242 S + +N + N + + N N S N G FC T Sbjct: 238 SNNNNNNNNNNNNNNGANDNGNGNGASNNNNNGDMFCHT 276 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 1.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 326 PSAKQQGFTHKSQSPQSNEKHRP 258 P+ QQG PQS E ++P Sbjct: 1002 PANAQQGQAQAQAKPQSQEANKP 1024 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 21.4 bits (43), Expect = 4.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 274 FDCGDCDLCVNPCCLAL 324 F G C+ +NPC AL Sbjct: 48 FWLGYCNSAINPCIYAL 64 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 4.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 274 FDCGDCDLCVNPCCLAL 324 F G C+ +NPC AL Sbjct: 496 FWLGYCNSAINPCIYAL 512 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,375 Number of Sequences: 438 Number of extensions: 2747 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10379628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -