BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_I11 (402 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81579-9|CAN99688.1| 225|Caenorhabditis elegans Hypothetical pr... 31 0.31 AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical ... 27 3.8 U39472-9|AAK31390.2| 327|Caenorhabditis elegans Serpentine rece... 27 6.7 Z73905-2|CAA98109.3| 529|Caenorhabditis elegans Hypothetical pr... 26 8.8 >Z81579-9|CAN99688.1| 225|Caenorhabditis elegans Hypothetical protein R13H4.2a protein. Length = 225 Score = 31.1 bits (67), Expect = 0.31 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +1 Query: 211 LTEDIGFNSYYYYFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRY 357 L +D ++ YYY+ + ++ S RY + Y+N Y TRY Sbjct: 71 LYDDYWYDKYYYFSPLYRSTYYPSRRYSYSDYLPNPYYWNNYGSYWTRY 119 Score = 26.6 bits (56), Expect = 6.7 Identities = 18/85 (21%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +1 Query: 139 EQYVYYAN-YSNTFLYNNEEQRLTYLTEDIGFNSYYYYFHSHLPFWWSSERYGNLKHRRG 315 ++Y Y++ Y +T+ + YL +N+Y Y+ + +W+ + Y + R Sbjct: 78 DKYYYFSPLYRSTYYPSRRYSYSDYLPNPYYWNNYGSYWTRYKGYWYDYD-YPSSYRRYT 136 Query: 316 EIYYNFYQQLTTRYYFERLTNGLGS 390 + +N Y T Y L + L + Sbjct: 137 DSAFNRYLNYTYTPYRSYLMDSLST 161 >AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical protein K03H6.2 protein. Length = 348 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 259 HLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYY 360 HLPF + + + H R EI+YN + + Y+ Sbjct: 264 HLPFQYELVDHDKMYHHRTEIWYNNDMSIGSSYH 297 >U39472-9|AAK31390.2| 327|Caenorhabditis elegans Serpentine receptor, class a (alpha)protein 33 protein. Length = 327 Score = 26.6 bits (56), Expect = 6.7 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = -1 Query: 189 IIVKESVGIVGVIHILLFLFYNSII 115 ++ SV I+G+I ++LF FY++ + Sbjct: 228 VVSSISVAILGIIQLVLFCFYDTFL 252 >Z73905-2|CAA98109.3| 529|Caenorhabditis elegans Hypothetical protein C32C4.1 protein. Length = 529 Score = 26.2 bits (55), Expect = 8.8 Identities = 15/68 (22%), Positives = 25/68 (36%) Frame = +1 Query: 166 SNTFLYNNEEQRLTYLTEDIGFNSYYYYFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQL 345 S T +++ TY+ ++G SYY + W + H + + Sbjct: 50 STTITHDSGSNADTYMRLNVGGKSYYVRAELYTSEWTRMHELLDSSHEERLKMVDGFDSK 109 Query: 346 TTRYYFER 369 T YY ER Sbjct: 110 TGEYYLER 117 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,994,710 Number of Sequences: 27780 Number of extensions: 176468 Number of successful extensions: 465 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 630384202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -