BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_I10 (530 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8342| Best HMM Match : FKBP_C (HMM E-Value=0) 175 1e-44 SB_19729| Best HMM Match : No HMM Matches (HMM E-Value=.) 125 3e-29 SB_53649| Best HMM Match : FKBP_C (HMM E-Value=4.1e-05) 35 0.036 SB_830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_52570| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) 28 4.1 SB_57753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55256| Best HMM Match : Lamp (HMM E-Value=0.55) 28 4.1 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 28 5.4 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) 28 5.4 SB_1724| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_2216| Best HMM Match : WD40 (HMM E-Value=9.6e-16) 27 7.2 SB_12811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_8342| Best HMM Match : FKBP_C (HMM E-Value=0) Length = 266 Score = 175 bits (427), Expect = 1e-44 Identities = 85/158 (53%), Positives = 110/158 (69%), Gaps = 2/158 (1%) Frame = +1 Query: 61 VFVMLALVGATI-ADSEVTELKIDVLSVPEGCTTKSKDGDMLTMHYTGTLSDGHKFDSSF 237 + ++A G + A+ ELKI+V+S PE CT K+ GD L+MHYTG L++G+KFDSS Sbjct: 7 LLAIVAFSGLALGAEEPKGELKIEVVSKPEKCTRKTHVGDTLSMHYTGRLANGNKFDSSL 66 Query: 238 DRDQPFTFQLGVGQVIKGWDQGLRDMCVGEKRKLTIPSSLGYGNRGAGNVIPPHATLHFE 417 DR + F F LG G VI+GW+QGL DMC+GEKRKLTIP L YG GAG IPPHATL+ + Sbjct: 67 DRGKTFDFTLGKGMVIQGWEQGLLDMCIGEKRKLTIPPHLAYGENGAGAAIPPHATLYMD 126 Query: 418 VELINI-GDSPPNTNVFKEIDADQNNMLSREEVSEYLK 528 VEL+ I G + NVF ID + + +L++EEV YLK Sbjct: 127 VELVEIQGSKESDPNVFGMIDKNNDKVLTQEEVKNYLK 164 >SB_19729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 125 bits (301), Expect = 3e-29 Identities = 59/145 (40%), Positives = 94/145 (64%), Gaps = 7/145 (4%) Frame = +1 Query: 115 ELKIDVLSVPEGCTTKSKDGDMLTMHYTGTLSDGHKFDSSFDRD---QPFTFQLGVGQVI 285 +++++ VP C K+K GD + +HYTG + DG FD++ D QPF F +G G VI Sbjct: 99 KIEVEETFVPSDCENKTKVGDHVVVHYTGWMQDGSLFDTTRDHRKGYQPFEFTIGGGTVI 158 Query: 286 KGWDQGLRDMCVGEKRKLTIPSSLGYGNRGA----GNVIPPHATLHFEVELINIGDSPPN 453 KG++QG+ MCVG+KRK+ IP +L YG +G+ GN+ + TL + +EL ++ PP+ Sbjct: 159 KGFEQGVTGMCVGQKRKIVIPPALAYGKKGSGDVPGNLDLTNTTLTYNLELFDVRKPPPH 218 Query: 454 TNVFKEIDADQNNMLSREEVSEYLK 528 +++F +D + + LSREEVS Y++ Sbjct: 219 SDMFSHMDENGDRKLSREEVSAYMR 243 >SB_53649| Best HMM Match : FKBP_C (HMM E-Value=4.1e-05) Length = 639 Score = 35.1 bits (77), Expect = 0.036 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = +1 Query: 172 GDMLTMHYTGTLSD----GHKFDSSFDRDQPFTFQLGVGQVIKG 291 GD + + YTG L + G FDS+ D+ F F+ G G+VIKG Sbjct: 122 GDAVEVKYTGWLLENGNFGKVFDSNAGTDKTFKFKTGKGKVIKG 165 >SB_830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 30.3 bits (65), Expect = 1.0 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +1 Query: 220 KFDSSF--DRDQPFTFQLGVGQVIKGWDQGLRDMCVGEKRKL-TIPSSLGYGNRG 375 K DS+F + +P +F +G GWD G G +KL T PS+ G N G Sbjct: 291 KLDSTFIWSKIRPMSFPCVLGMHEVGWDDGTFHSSTGAAQKLGTRPSNGGTKNSG 345 >SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.5 bits (63), Expect = 1.8 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 6/84 (7%) Frame = +3 Query: 261 SARRRSSHQRLGSRTSRH-VCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRSRTNQH- 434 S S H+ TSRH R ET + H + R TSRH S R +T++H Sbjct: 37 SRHETSRHESSPHETSRHETSRHET-SRHERSRHETRQHERSRHKTSRHESSRHKTSRHG 95 Query: 435 --R*LTPEHQ--RVQGNRRGPKQH 494 R T H+ R + +R +QH Sbjct: 96 RSRHKTSRHETSRHERSRHETRQH 119 Score = 27.1 bits (57), Expect = 9.5 Identities = 23/79 (29%), Positives = 30/79 (37%), Gaps = 1/79 (1%) Frame = +3 Query: 261 SARRRSSHQRLGSRTSRHV-CR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRSRTNQHR 437 S RS H+ +TSRH R ET + H TSRH R T QH Sbjct: 17 SRHERSRHESNRHKTSRHERSRHET-SRHESSPHETSRHETSRHETSRHERSRHETRQHE 75 Query: 438 *LTPEHQRVQGNRRGPKQH 494 + R + +R +H Sbjct: 76 RSRHKTSRHESSRHKTSRH 94 >SB_52570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/66 (27%), Positives = 33/66 (50%) Frame = -3 Query: 330 FLTYTHVSKSLIPAFDDLTDAELKGEWLIAIKTGVELMTIAQSTRVVHGQHITIFRLRST 151 + T ++ ++ +IP D LT +++ TG TI+ + R V H+T ++R+T Sbjct: 4 YQTNSYANRCVIP--DHLTRQQVRTTRPSHTPTGAYYQTISHANRCVLPDHLTRQQVRTT 61 Query: 150 SFGHAQ 133 H Q Sbjct: 62 RPSHTQ 67 >SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3511 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 363 VAQGRRDGQFTFLTYTHVSKSLIPAFDDLTD 271 + +G +DG + FL H+S S +P D L + Sbjct: 3218 IKEGVKDGNWVFLANCHLSLSWMPQLDKLVE 3248 >SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) Length = 428 Score = 28.3 bits (60), Expect = 4.1 Identities = 23/66 (34%), Positives = 30/66 (45%) Frame = +3 Query: 240 SRSAIHLSARRRSSHQRLGSRTSRHVCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRS 419 SRS+ LS+RRRS H+R R + + SRSR R S RS Sbjct: 279 SRSS-SLSSRRRSKHKRKSKRDRSRSRDRSSSKSKSLRRSKKYSRSRSRSSERRRRS-RS 336 Query: 420 RTNQHR 437 R+ +HR Sbjct: 337 RSTEHR 342 >SB_57753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +1 Query: 442 SPPNTNVFKEIDADQNNMLSREEVSEYLK 528 SPPNT I+ D ++ LSREE++EY + Sbjct: 225 SPPNTA--NRIEDDGDDELSREEMAEYTR 251 >SB_55256| Best HMM Match : Lamp (HMM E-Value=0.55) Length = 284 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = -1 Query: 185 VSISPSLDFVVHPSGTLKTSILSSVTSESAIVAPTRANITKTQ 57 V+I PS +H S ++ S+ SSV S VAPT T T+ Sbjct: 48 VTIVPST-ISMHSSPSISVSVASSVMPSSTSVAPTTPPATTTK 89 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 27.9 bits (59), Expect = 5.4 Identities = 24/62 (38%), Positives = 33/62 (53%) Frame = +3 Query: 243 RSAIHLSARRRSSHQRLGSRTSRHVCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRSR 422 RS H S R RS H+R SR++ R +D F R+SRSR + + HS RSR Sbjct: 256 RSRYHRS-RSRSRHRR--SRSNSPSMRK---SDRKFKKSQRKSRSRSRNRSRSHSRKRSR 309 Query: 423 TN 428 ++ Sbjct: 310 SS 311 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 27.9 bits (59), Expect = 5.4 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 264 ARRRSSHQRLGSRTSRHVCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRSRTN-QHR 437 +R RS +R SR+ R R + + H +SRSR P RHS RS T+ +HR Sbjct: 226 SRSRSPRRRRRSRSPRRRRRSRSPSPHH---RSHRSRSRSRSPRRRHSRSRSPTHRRHR 281 >SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) Length = 1023 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 127 DVLSVPEGCTTKSKDGDML-TMHYTGTLSDGHKFDSSFDR 243 D VP GC + + DG++L + T + + H D +FDR Sbjct: 59 DEPGVPAGCNSTAFDGNILEAYNLTMNIFEKHFVDRTFDR 98 >SB_1724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 899 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/64 (26%), Positives = 33/64 (51%) Frame = -3 Query: 330 FLTYTHVSKSLIPAFDDLTDAELKGEWLIAIKTGVELMTIAQSTRVVHGQHITIFRLRST 151 + T ++ ++ ++P D LT +++ TGV TI+ + R V H+T ++R+T Sbjct: 643 YQTISYANRCVLP--DHLTRQQVRTTRPSHTPTGVYYQTISHANRCVLPDHLTRQQVRTT 700 Query: 150 SFGH 139 H Sbjct: 701 RPSH 704 >SB_2216| Best HMM Match : WD40 (HMM E-Value=9.6e-16) Length = 400 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 409 HFEVELINIGDSPPN 453 H+E+ IN+ DSPPN Sbjct: 231 HYEITCINVRDSPPN 245 >SB_12811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1254 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/64 (25%), Positives = 32/64 (50%) Frame = -3 Query: 330 FLTYTHVSKSLIPAFDDLTDAELKGEWLIAIKTGVELMTIAQSTRVVHGQHITIFRLRST 151 + T +H ++ ++P D L +++ +TG TI+ + R V H+T ++R+T Sbjct: 664 YQTISHANRCVLP--DHLIRQQVRTTRPSNTQTGAYYQTISHANRCVLPDHLTRQQVRTT 721 Query: 150 SFGH 139 H Sbjct: 722 RPSH 725 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,146,357 Number of Sequences: 59808 Number of extensions: 332040 Number of successful extensions: 892 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -