BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_I07 (590 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41264-7|AAA82427.2| 819|Caenorhabditis elegans Hypothetical pr... 33 0.15 Z68108-1|CAA92134.1| 194|Caenorhabditis elegans Hypothetical pr... 28 4.3 >U41264-7|AAA82427.2| 819|Caenorhabditis elegans Hypothetical protein F10E7.4 protein. Length = 819 Score = 33.1 bits (72), Expect = 0.15 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +2 Query: 383 HPDLDSDT-VAYLWTAPNDITGEVKFRASIIQSFVIFWVGIESPPVKI 523 H +L S T V +W AP +G V FRAS+I++ I++ E VK+ Sbjct: 125 HANLKSKTSVHMMWKAPEVSSGCVVFRASVIETKYIWFTEAEGLTVKL 172 >Z68108-1|CAA92134.1| 194|Caenorhabditis elegans Hypothetical protein T05A10.2 protein. Length = 194 Score = 28.3 bits (60), Expect = 4.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -1 Query: 218 LELNYQASLWLCLG*WCMVVV 156 L +N ++ W+ +G WC+VV+ Sbjct: 158 LNINIGSAFWMAVGAWCLVVI 178 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,750,547 Number of Sequences: 27780 Number of extensions: 294737 Number of successful extensions: 888 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 887 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1247656244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -