Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I10A02NGRL0005_I03
(642 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 29 0.17
AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 29 0.17
Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein... 24 4.7
AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 24 4.7
EF519478-1|ABP73565.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519477-1|ABP73563.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519476-1|ABP73561.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519475-1|ABP73559.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519474-1|ABP73557.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519473-1|ABP73555.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519472-1|ABP73553.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519471-1|ABP73551.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519470-1|ABP73549.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519469-1|ABP73547.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519468-1|ABP73545.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519467-1|ABP73543.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519466-1|ABP73541.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519465-1|ABP73539.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519464-1|ABP73537.1| 160|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519463-1|ABP73535.1| 162|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519462-1|ABP73533.1| 147|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519461-1|ABP73531.1| 147|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519460-1|ABP73529.1| 157|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519459-1|ABP73527.1| 157|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519458-1|ABP73525.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519457-1|ABP73523.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519456-1|ABP73521.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519455-1|ABP73519.1| 163|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519454-1|ABP73517.1| 164|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519453-1|ABP73515.1| 163|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519452-1|ABP73513.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519451-1|ABP73511.1| 151|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519450-1|ABP73509.1| 151|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519449-1|ABP73507.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519448-1|ABP73505.1| 151|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519447-1|ABP73503.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519446-1|ABP73501.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519445-1|ABP73499.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519444-1|ABP73497.1| 154|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519443-1|ABP73495.1| 165|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519442-1|ABP73493.1| 162|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519441-1|ABP73491.1| 174|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519440-1|ABP73489.1| 174|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519439-1|ABP73487.1| 174|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519438-1|ABP73485.1| 164|Anopheles gambiae CTLMA2 protein. 23 6.2
EF519437-1|ABP73483.1| 147|Anopheles gambiae CTLMA2 protein. 23 6.2
AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 8.2
AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 8.2
>AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase
isoform 2 protein.
Length = 484
Score = 28.7 bits (61), Expect = 0.17
Identities = 21/85 (24%), Positives = 36/85 (42%), Gaps = 1/85 (1%)
Frame = +1
Query: 295 VNGDSYKYSDFKCTE-EIEPKVSHTGQSCFYGDTEWIKIGYEKFGQFLSAYSVCLDKRNN 471
V+ D+Y S F C E K T S + +W+ + ++ +L ++ N
Sbjct: 275 VHVDAYAGSAFICPEYRYLMKGIETADSFNFNPHKWMLVNFDCSAMWLKEPYWIVNAFNV 334
Query: 472 IPIYAKHNMDRYLAGIEPESSKWVV 546
P+Y KH+M G P+ W +
Sbjct: 335 DPLYLKHDMQ----GSAPDYRHWQI 355
>AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase
isoform 1 protein.
Length = 515
Score = 28.7 bits (61), Expect = 0.17
Identities = 21/85 (24%), Positives = 36/85 (42%), Gaps = 1/85 (1%)
Frame = +1
Query: 295 VNGDSYKYSDFKCTE-EIEPKVSHTGQSCFYGDTEWIKIGYEKFGQFLSAYSVCLDKRNN 471
V+ D+Y S F C E K T S + +W+ + ++ +L ++ N
Sbjct: 306 VHVDAYAGSAFICPEYRYLMKGIETADSFNFNPHKWMLVNFDCSAMWLKEPYWIVNAFNV 365
Query: 472 IPIYAKHNMDRYLAGIEPESSKWVV 546
P+Y KH+M G P+ W +
Sbjct: 366 DPLYLKHDMQ----GSAPDYRHWQI 386
>Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein
protein.
Length = 192
Score = 23.8 bits (49), Expect = 4.7
Identities = 18/86 (20%), Positives = 33/86 (38%)
Frame = +1
Query: 277 QEISFTVNGDSYKYSDFKCTEEIEPKVSHTGQSCFYGDTEWIKIGYEKFGQFLSAYSVCL 456
+++ DS K +D + I P+ + + F + IG G F A+ C+
Sbjct: 35 EQLPILPTADSSKPTD-DTVKAIAPQPRYLLPADFAVKNKKFTIGTLGVGSFFRAWRNCI 93
Query: 457 DKRNNIPIYAKHNMDRYLAGIEPESS 534
D+ + +YL + SS
Sbjct: 94 DEGKGLATIESEKEQKYLESLLKASS 119
>AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1
chain protein.
Length = 1024
Score = 23.8 bits (49), Expect = 4.7
Identities = 10/37 (27%), Positives = 20/37 (54%)
Frame = -2
Query: 410 PILIHSVSP*KQDCPVCETLGSISSVHLKSEYL*ESP 300
P+ + + P C VCE ++ +VH ++ ++ E P
Sbjct: 890 PVTENEMRPYISRCTVCEAPTNVIAVHSQTLHIPECP 926
>EF519478-1|ABP73565.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519477-1|ABP73563.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519476-1|ABP73561.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519475-1|ABP73559.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519474-1|ABP73557.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519473-1|ABP73555.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519472-1|ABP73553.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519471-1|ABP73551.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519470-1|ABP73549.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519469-1|ABP73547.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519468-1|ABP73545.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519467-1|ABP73543.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519466-1|ABP73541.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519465-1|ABP73539.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519464-1|ABP73537.1| 160|Anopheles gambiae CTLMA2 protein.
Length = 160
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 137 DKYEWNDFQCTQQ 149
>EF519463-1|ABP73535.1| 162|Anopheles gambiae CTLMA2 protein.
Length = 162
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 139 DKYEWNDFQCTQQ 151
>EF519462-1|ABP73533.1| 147|Anopheles gambiae CTLMA2 protein.
Length = 147
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 124 DKYEWNDFQCTQQ 136
>EF519461-1|ABP73531.1| 147|Anopheles gambiae CTLMA2 protein.
Length = 147
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 124 DKYEWNDFQCTQQ 136
>EF519460-1|ABP73529.1| 157|Anopheles gambiae CTLMA2 protein.
Length = 157
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 134 DKYEWNDFQCTQQ 146
>EF519459-1|ABP73527.1| 157|Anopheles gambiae CTLMA2 protein.
Length = 157
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 134 DKYEWNDFQCTQQ 146
>EF519458-1|ABP73525.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519457-1|ABP73523.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519456-1|ABP73521.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519455-1|ABP73519.1| 163|Anopheles gambiae CTLMA2 protein.
Length = 163
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 140 DKYEWNDFQCTQQ 152
>EF519454-1|ABP73517.1| 164|Anopheles gambiae CTLMA2 protein.
Length = 164
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 141 DKYEWNDFQCTQQ 153
>EF519453-1|ABP73515.1| 163|Anopheles gambiae CTLMA2 protein.
Length = 163
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 140 DKYEWNDFQCTQQ 152
>EF519452-1|ABP73513.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519451-1|ABP73511.1| 151|Anopheles gambiae CTLMA2 protein.
Length = 151
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 128 DKYEWNDFQCTQQ 140
>EF519450-1|ABP73509.1| 151|Anopheles gambiae CTLMA2 protein.
Length = 151
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 128 DKYEWNDFQCTQQ 140
>EF519449-1|ABP73507.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519448-1|ABP73505.1| 151|Anopheles gambiae CTLMA2 protein.
Length = 151
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 128 DKYEWNDFQCTQQ 140
>EF519447-1|ABP73503.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519446-1|ABP73501.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519445-1|ABP73499.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519444-1|ABP73497.1| 154|Anopheles gambiae CTLMA2 protein.
Length = 154
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 131 DKYEWNDFQCTQQ 143
>EF519443-1|ABP73495.1| 165|Anopheles gambiae CTLMA2 protein.
Length = 165
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 142 DKYEWNDFQCTQQ 154
>EF519442-1|ABP73493.1| 162|Anopheles gambiae CTLMA2 protein.
Length = 162
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 139 DKYEWNDFQCTQQ 151
>EF519441-1|ABP73491.1| 174|Anopheles gambiae CTLMA2 protein.
Length = 174
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 151 DKYEWNDFQCTQQ 163
>EF519440-1|ABP73489.1| 174|Anopheles gambiae CTLMA2 protein.
Length = 174
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 151 DKYEWNDFQCTQQ 163
>EF519439-1|ABP73487.1| 174|Anopheles gambiae CTLMA2 protein.
Length = 174
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 151 DKYEWNDFQCTQQ 163
>EF519438-1|ABP73485.1| 164|Anopheles gambiae CTLMA2 protein.
Length = 164
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 141 DKYEWNDFQCTQQ 153
>EF519437-1|ABP73483.1| 147|Anopheles gambiae CTLMA2 protein.
Length = 147
Score = 23.4 bits (48), Expect = 6.2
Identities = 6/13 (46%), Positives = 12/13 (92%)
Frame = +1
Query: 304 DSYKYSDFKCTEE 342
D Y+++DF+CT++
Sbjct: 124 DKYEWNDFQCTQQ 136
>AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative
5-oxoprolinase protein.
Length = 756
Score = 23.0 bits (47), Expect = 8.2
Identities = 8/27 (29%), Positives = 15/27 (55%)
Frame = -3
Query: 286 LFPDRRTLRYCSSGSS*TPLDRLIESI 206
++P++ T+ Y GS P RL+ +
Sbjct: 633 IYPEKTTVAYFEEGSGQAPPGRLVTPV 659
>AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative
5-oxoprolinase protein.
Length = 1344
Score = 23.0 bits (47), Expect = 8.2
Identities = 8/27 (29%), Positives = 15/27 (55%)
Frame = -3
Query: 286 LFPDRRTLRYCSSGSS*TPLDRLIESI 206
++P++ T+ Y GS P RL+ +
Sbjct: 677 IYPEKTTVAYFEEGSGQAPPGRLVTPV 703
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 704,156
Number of Sequences: 2352
Number of extensions: 15984
Number of successful extensions: 61
Number of sequences better than 10.0: 48
Number of HSP's better than 10.0 without gapping: 61
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63141405
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -