BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_I02 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 40 3e-05 AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 28 0.090 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 1.5 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 1.9 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 2.6 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 4.5 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.9 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 5.9 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 5.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 5.9 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 39.5 bits (88), Expect = 3e-05 Identities = 17/42 (40%), Positives = 30/42 (71%) Frame = +2 Query: 455 NTKITQYPWLVVIEYESFDHMKLLCGGSLISSKYVLTAAHCV 580 NT I ++P + I+ +++ ++CG ++IS +YVLTAAHC+ Sbjct: 166 NTGINEFPMMAGIK-RTYEP-GMICGATIISKRYVLTAAHCI 205 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 27.9 bits (59), Expect = 0.090 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 356 RCSRAVTAFPLESNNECCGVEDTVVNKIVRCEMNTKITQY 475 RC A+ P E CG+ +T N I++C+++ + Y Sbjct: 31 RCPEALFQ-PSFLGMEACGIHETTYNSIMKCDVDIRKDLY 69 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 146 ISNACKTPDDKP 181 ++NACK DDKP Sbjct: 392 LTNACKKKDDKP 403 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = -2 Query: 568 SSEHVLRTDE*ATA*QLHMIKTLIFDHHKPWILGDFCVHFAPXNFINN 425 +S H+L + T+ L+ + +DH K ++G F + + + NN Sbjct: 24 NSVHILSKYQLITSTTLNWLPRTHYDHLKEIVIGGFEIEKSEDDSFNN 71 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -1 Query: 182 PVYRLESYKRLKW 144 P YRLE KRL W Sbjct: 333 PKYRLELQKRLPW 345 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 234 IRPERVKWITFDNPF 278 I PER ++I F PF Sbjct: 525 INPERAEFIEFSKPF 539 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +1 Query: 559 AHCCTLCHWSNLD 597 AHC LCH + D Sbjct: 741 AHCFALCHCCDFD 753 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 128 VYYSHNHIVSLLKVSYPQLFCFY 60 ++Y+ N IV + +SY + FY Sbjct: 236 LFYTVNLIVPCVSISYLSVLAFY 258 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -1 Query: 125 YYSHNHIVSLLKVSYPQLFCF 63 YYS+ +++L+ S P C+ Sbjct: 640 YYSYIGVLTLVATSMPTYICY 660 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +2 Query: 209 EHITYMMLDKTRKSKMDYVRQSVCNGPETFSVCCGPPPEINP 334 +H+ Y +S YV +G + F+ C P P P Sbjct: 362 QHLHYRQPPTLSESYSSYVNSMYASGAQ-FATPCTPSPPRGP 402 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,823 Number of Sequences: 438 Number of extensions: 4245 Number of successful extensions: 17 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -