BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_I01 (604 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 25 1.9 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 5.8 AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CY... 23 5.8 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 5.8 CR954257-7|CAJ14158.1| 284|Anopheles gambiae signal sequence re... 23 7.6 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 25.0 bits (52), Expect = 1.9 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 335 IQGSGPVHLIG 367 I GSGPVHLIG Sbjct: 194 IAGSGPVHLIG 204 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.4 bits (48), Expect = 5.8 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 319 CHIHSYTGFRTCSFDWSPSAW 381 CH H RTC + ++ S W Sbjct: 271 CHQHEPQEIRTCHWGFNSSNW 291 >AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CYP4H15 protein. Length = 151 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 167 ALLGPDAKADELNVVQVETMSLQESV 244 A++GPDAK EL ++ + E V Sbjct: 40 AIVGPDAKTQELTYGTLQELKYLEMV 65 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.4 bits (48), Expect = 5.8 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +2 Query: 200 LNVVQVETMSLQESVKIPVAVLKAGETRHARLDFEFPDAP 319 LNV+ S+ E KI ++++ + D +PD P Sbjct: 1114 LNVLDTRRKSMAEQRKIRKSIIRGQNPYDSAGDLWYPDEP 1153 >CR954257-7|CAJ14158.1| 284|Anopheles gambiae signal sequence receptor protein. Length = 284 Score = 23.0 bits (47), Expect = 7.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 522 TLKAKPLHPRRMRRSEPPVSPRDRRA 599 TLK P+ +S P SPR R+A Sbjct: 256 TLKQLQNSPKGAPKSSPKQSPRQRKA 281 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 499,270 Number of Sequences: 2352 Number of extensions: 8806 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -