BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_H23 (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 36 0.020 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 36 0.027 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 33 0.19 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 32 0.25 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 32 0.33 SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) 32 0.33 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_15403| Best HMM Match : CH (HMM E-Value=0) 32 0.33 SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) 31 0.44 SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) 31 0.44 SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 31 0.58 SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) 31 0.58 SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) 30 1.0 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 3.1 SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) 28 4.1 SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) 28 4.1 SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) 28 4.1 SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) 28 5.4 SB_21821| Best HMM Match : MRG (HMM E-Value=0) 28 5.4 SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) 27 7.1 SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) 27 7.1 SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 27 9.4 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 35.9 bits (79), Expect = 0.020 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTYQKP 478 +C C T E NPVCGSD KTY P Sbjct: 117 RCMRRC--TKELNPVCGSDGKTYDNP 140 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 398 EKCAENCISTPEYNPVCGSDDKTYQKP 478 +KCA C Y PVCGSD+ TY P Sbjct: 167 DKCAPIC--NKMYQPVCGSDNVTYSNP 191 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 395 IEKCAENCISTPEYNPVCGSDDKTY 469 ++ C C + Y PVCG+D KTY Sbjct: 41 VDPCVRPCPAI--YMPVCGTDGKTY 63 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 35.5 bits (78), Expect = 0.027 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = +2 Query: 389 QTIEKCAENCISTPEYNPVCGSDDKTYQKP 478 Q + C E C T EY PVCGSD KTY P Sbjct: 37 QPVCVCNEAC--TREYAPVCGSDGKTYPNP 64 Score = 31.5 bits (68), Expect = 0.44 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTY 469 +C + C T +Y PVCGSD+KTY Sbjct: 195 ECPKVC--TLDYTPVCGSDNKTY 215 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTYQKPGKTIL 493 +C + C T EY P CG+D TY P + +L Sbjct: 278 ECPKAC--TREYKPACGTDGNTY--PNRCVL 304 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTY 469 +C C T E PVCG+D KTY Sbjct: 117 ECPRAC--TRELMPVCGTDQKTY 137 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDDKTY 469 C ENC ST + PVCGSD+ TY Sbjct: 275 CPENCSSTVD--PVCGSDNNTY 294 Score = 31.5 bits (68), Expect = 0.44 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDDKTY 469 C ENC ST + PVCG+D+ TY Sbjct: 161 CPENCSSTVD--PVCGTDNNTY 180 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDDKTY 469 C ENC ST + PVCGSD+ TY Sbjct: 1206 CPENCSSTVD--PVCGSDNNTY 1225 Score = 31.5 bits (68), Expect = 0.44 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDDKTY 469 C ENC ST + PVCG+D+ TY Sbjct: 1135 CPENCSSTVD--PVCGTDNNTY 1154 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTY 469 +C+E+C T PVCGSD+ Y Sbjct: 1372 ECSEDCPKT--LKPVCGSDNNDY 1392 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 398 EKCAENCISTPEYNPVCGSDDKTYQKP 478 +KCA C Y PVCGSD+ TY P Sbjct: 24 DKCAPIC--NKMYQPVCGSDNVTYSNP 48 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 31.9 bits (69), Expect = 0.33 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +2 Query: 389 QTIEKCAENCISTPEYNPVCGSDDKTY 469 Q + +C C T EY PVCGSD KTY Sbjct: 42 QPVCECPMAC--TREYAPVCGSDGKTY 66 >SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) Length = 85 Score = 31.9 bits (69), Expect = 0.33 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 398 EKCAENCISTPEYNPVCGSDDKTYQKP 478 +KCA C Y PVCGSD+ TY P Sbjct: 38 DKCAPICPKI--YRPVCGSDNVTYSNP 62 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 31.9 bits (69), Expect = 0.33 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDDKTYQ 472 C +NC ST + PVCGSD KTY+ Sbjct: 3970 CNKNCPSTSK--PVCGSDGKTYK 3990 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTYQ 472 +C C+ P+ PVCG+D KTY+ Sbjct: 4236 ECPSRCL--PDKEPVCGADGKTYR 4257 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 31.9 bits (69), Expect = 0.33 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTY 469 KC + T EY PVCGSD TY Sbjct: 721 KCVCSAACTREYAPVCGSDGNTY 743 Score = 29.5 bits (63), Expect = 1.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTY 469 +C + P Y+P+CG+D KTY Sbjct: 1232 RCECDLRPDPAYDPICGTDGKTY 1254 >SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) Length = 77 Score = 31.5 bits (68), Expect = 0.44 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +2 Query: 401 KCAEN-CISTPEYNPVCGSDDKTY 469 KC ++ + T +Y+PVCGSD KTY Sbjct: 24 KCDDSPTLCTLQYDPVCGSDGKTY 47 >SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) Length = 143 Score = 31.5 bits (68), Expect = 0.44 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDDKTY 469 C ENC ST + PVCG+D+ TY Sbjct: 27 CPENCSSTVD--PVCGTDNNTY 46 >SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 31.5 bits (68), Expect = 0.44 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 425 TPEYNPVCGSDDKTY 469 T +YNPVCGSD +TY Sbjct: 15 TADYNPVCGSDGRTY 29 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 31.1 bits (67), Expect = 0.58 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDDKTY 469 C+ I T EY+P+CGSD KTY Sbjct: 5152 CSCPDICTFEYSPLCGSDGKTY 5173 Score = 30.7 bits (66), Expect = 0.76 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDDKTY 469 C N I T EY PVCG+D ++Y Sbjct: 5222 CTCNSICTLEYAPVCGTDGQSY 5243 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +2 Query: 416 CISTPEYN-PVCGSDDKTY 469 C S P N PVCGSD KTY Sbjct: 5621 CQSCPSINKPVCGSDGKTY 5639 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +2 Query: 416 CISTPEY-NPVCGSDDKTY 469 C+S P +PVCGSD K Y Sbjct: 5790 CLSCPNILDPVCGSDGKNY 5808 >SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) Length = 92 Score = 31.1 bits (67), Expect = 0.58 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 395 IEKCAENCISTPEYNPVCGSDDKTY 469 I +C N T Y PVCG+D KTY Sbjct: 34 IVRCVCNRACTKIYRPVCGTDGKTY 58 >SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) Length = 361 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 416 CISTPEYNPVCGSDDKTYQKP 478 C+ + ++NPVCG+DD TY P Sbjct: 137 CVKS-QFNPVCGADDVTYFTP 156 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTY 469 KC C T EY PVCG+D KTY Sbjct: 1294 KCPIFC--TYEYMPVCGTDGKTY 1314 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTY 469 +C ++T EY PVC SD K Y Sbjct: 1966 ECVCRTVTTLEYRPVCASDGKIY 1988 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTY 469 KC + + T +Y PVC SD KTY Sbjct: 1522 KCRQ--MMTADYTPVCASDGKTY 1542 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTYQ 472 KC + I +P +PVCGSD K Y+ Sbjct: 1753 KCPPS-ICSPVISPVCGSDGKIYK 1775 >SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 92 ALLILGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRP 226 A +I GF+ + C +RY Q+ N +N W+ S NRP Sbjct: 6 ATIIRGFLKFRIICEKVRYFTQLRACYN--PQQNKWDTSHTNNRP 48 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDDKTYQ 472 C NC S +++PVCG D TYQ Sbjct: 579 CPTNCPS--DWDPVCGDDGVTYQ 599 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 431 EYNPVCGSDDKTYQKPGK 484 E +PVCGSD KTY+ K Sbjct: 516 EASPVCGSDGKTYENECK 533 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTY 469 KC+ P PVCGSD K+Y Sbjct: 1679 KCSCPIYCPPSGQPVCGSDGKSY 1701 >SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) Length = 997 Score = 28.3 bits (60), Expect = 4.1 Identities = 24/68 (35%), Positives = 31/68 (45%) Frame = +2 Query: 104 LGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNY 283 LG I SQA NIR Q N +L + N + P+Q GY+ PL +NY Sbjct: 612 LGQITSQAIGSNIR---QDVANVSLPLQMPISNPKTSVPQGGATPMQFGYQGYGPLQHNY 668 Query: 284 NFIAFIFP 307 + IFP Sbjct: 669 GDMNTIFP 676 >SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) Length = 69 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 395 IEKCAENCISTPEYN-PVCGSDDKTY 469 ++KC C P N PVCG+D KTY Sbjct: 21 VDKCVRPC---PAINDPVCGTDGKTY 43 >SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 28.3 bits (60), Expect = 4.1 Identities = 9/37 (24%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +3 Query: 15 LYLYLCYKICHINYFYY----YNLKWISCARFLYWVL 113 ++L+ +CH+NY Y+ +++ W+ ++Y V+ Sbjct: 121 IWLFHVSLLCHVNYMYHVIWLFHVSWLCHVNYMYHVI 157 >SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) Length = 98 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 395 IEKCAENCISTPEYNPVCGSDDKTY 469 I +C N Y+P+CG+D KTY Sbjct: 34 IARCVCNRACKKIYSPMCGTDGKTY 58 >SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) Length = 68 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDDKTY 469 C+ +C PVCGSDD TY Sbjct: 8 CSFSCDDGFHQTPVCGSDDVTY 29 >SB_21821| Best HMM Match : MRG (HMM E-Value=0) Length = 292 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 107 GFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIP 238 G + +A C+ + K E A I NGWNK+ D EW+P Sbjct: 18 GPLIYEAKCIRGQLK---EKTARYLIHYNGWNKNWD----EWVP 54 >SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) Length = 1376 Score = 27.5 bits (58), Expect = 7.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 404 CAENCISTPEYNPVC 448 C +CISTP Y+ +C Sbjct: 1196 CVHSCISTPRYDQIC 1210 >SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) Length = 87 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 413 NCISTPEYNPVCGSDDKTY 469 NC ST + PVCGSD+ TY Sbjct: 2 NCSSTVD--PVCGSDNNTY 18 >SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +2 Query: 416 CISTPEY-NPVCGSDDKTY 469 C+S P +PVCGSD K Y Sbjct: 111 CLSCPNILDPVCGSDGKNY 129 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +2 Query: 416 CISTPEY-NPVCGSDDKTY 469 C+S P +PVCGSD K Y Sbjct: 274 CLSCPNMLDPVCGSDGKNY 292 >SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 357 HQLLALVEHHDKQLRNARRIAFQHQNTTPC 446 H L AL +++R RRI+++ QNT C Sbjct: 84 HSLPALTFESARKVRQYRRISWEGQNTQTC 113 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDDKTY 469 +C E C S E +PVCG+D +TY Sbjct: 205 RCHEPCPS--EASPVCGTDMRTY 225 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDDKTY 469 C +C T Y+PVCG D TY Sbjct: 252 CPSDCSHT--YSPVCGGDKTTY 271 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,517,322 Number of Sequences: 59808 Number of extensions: 364554 Number of successful extensions: 1007 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -