BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_H22 (580 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 131 2e-32 AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical prote... 23 7.2 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 131 bits (316), Expect = 2e-32 Identities = 54/92 (58%), Positives = 74/92 (80%) Frame = +3 Query: 27 IKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECE 206 +KD +D +L AGD+LVV+DF ATWCGPCK+I PKL+E N+ +D IVV+KVDVDECE Sbjct: 5 VKDSEDFNNKLEAAGDQLVVVDFFATWCGPCKVIAPKLEEFQNKYADKIVVVKVDVDECE 64 Query: 207 DIAAEYNINAMPTFVFVKATKKLEEFSGANVD 302 ++AA+YNI +MPTF+F+K + + +FSGAN + Sbjct: 65 ELAAQYNIASMPTFLFIKRKEVVGQFSGANAE 96 >AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical protein protein. Length = 135 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 374 INYILIPFICLPKQYVN 424 I +L+P C PK VN Sbjct: 109 ITIVLLPIFCAPKSEVN 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 518,152 Number of Sequences: 2352 Number of extensions: 8985 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -