BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_H22 (580 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 91 4e-19 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 90 9e-19 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 84 7e-17 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 80 9e-16 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 80 9e-16 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 80 1e-15 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 79 3e-15 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 79 3e-15 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 77 6e-15 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 76 1e-14 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 75 3e-14 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 71 6e-13 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 71 7e-13 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 68 4e-12 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 66 2e-11 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 66 2e-11 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 65 3e-11 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 65 3e-11 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 62 3e-10 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 61 6e-10 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 60 8e-10 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 60 1e-09 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 59 2e-09 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 59 2e-09 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 59 2e-09 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 58 4e-09 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 58 6e-09 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 58 6e-09 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 55 4e-08 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 54 5e-08 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 54 5e-08 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 54 7e-08 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 53 2e-07 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 53 2e-07 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 52 2e-07 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 52 2e-07 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 51 5e-07 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 50 8e-07 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 50 8e-07 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 50 1e-06 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 49 2e-06 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 49 3e-06 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 48 3e-06 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 48 5e-06 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 47 1e-05 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 45 4e-05 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 45 4e-05 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 44 6e-05 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 43 1e-04 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 41 5e-04 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 41 7e-04 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 40 0.001 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 39 0.003 At4g12170.1 68417.m01934 thioredoxin family protein similar to S... 37 0.011 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 36 0.015 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 36 0.015 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 36 0.015 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 36 0.015 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 35 0.034 At3g03860.1 68416.m00398 expressed protein 35 0.045 At5g08290.1 68418.m00976 yellow-leaf-specific protein 8 (YLS8) /... 31 0.42 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 31 0.56 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 30 1.3 At4g31240.2 68417.m04435 expressed protein 28 3.9 At4g31240.1 68417.m04434 expressed protein 28 3.9 At1g64290.1 68414.m07285 F-box protein-related contains TIGRFAM ... 28 5.2 At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containi... 27 6.8 At3g07330.1 68416.m00874 glycosyl transferase family 2 protein s... 27 6.8 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 27 9.0 At4g31040.1 68417.m04408 proton extrusion protein-related contai... 27 9.0 At4g03415.1 68417.m00468 protein phosphatase 2C family protein /... 27 9.0 At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 27 9.0 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 91.5 bits (217), Expect = 4e-19 Identities = 38/91 (41%), Positives = 60/91 (65%) Frame = +3 Query: 24 HIKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDEC 203 H D ++ ++ +KL+VIDF A+WC PC+MI P +++A + S + KVDVDE Sbjct: 12 HTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDEL 71 Query: 204 EDIAAEYNINAMPTFVFVKATKKLEEFSGAN 296 + +A E+ + AMPTFVF+KA + +++ GAN Sbjct: 72 QSVAKEFGVEAMPTFVFIKAGEVVDKLVGAN 102 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 90.2 bits (214), Expect = 9e-19 Identities = 39/77 (50%), Positives = 56/77 (72%) Frame = +3 Query: 72 DKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFV 251 +KL+V+DF A+WCGPC+MI P + MA++ +D + +K+DVDE D+A E+N+ AMPTFV Sbjct: 47 NKLLVVDFSASWCGPCRMIEPAIHAMADKFND-VDFVKLDVDELPDVAKEFNVTAMPTFV 105 Query: 252 FVKATKKLEEFSGANVD 302 VK K++E GA D Sbjct: 106 LVKRGKEIERIIGAKKD 122 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 83.8 bits (198), Expect = 7e-17 Identities = 35/94 (37%), Positives = 63/94 (67%) Frame = +3 Query: 15 MSIHIKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDV 194 +SIH + KT+ ++ +L+++ F ATWCGPC+ + P +A + S +V LKVD+ Sbjct: 273 ISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHS-RVVFLKVDI 331 Query: 195 DECEDIAAEYNINAMPTFVFVKATKKLEEFSGAN 296 D+ D+AA +NI+++PTF F++ K++++ GA+ Sbjct: 332 DKANDVAASWNISSVPTFCFIRDGKEVDKVVGAD 365 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 80.2 bits (189), Expect = 9e-16 Identities = 37/96 (38%), Positives = 62/96 (64%), Gaps = 2/96 (2%) Frame = +3 Query: 21 IHIKDFDDLKTRLSEAGD--KLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDV 194 + IK+ + K+RL+ D KL+VI+F A WCGPCK + PKL+E+A + +D + +K+DV Sbjct: 40 VEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTD-VEFVKIDV 98 Query: 195 DECEDIAAEYNINAMPTFVFVKATKKLEEFSGANVD 302 D + E+N++ +P VF+K ++++ G VD Sbjct: 99 DVLMSVWMEFNLSTLPAIVFMKRGREVDMVVGVKVD 134 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 80.2 bits (189), Expect = 9e-16 Identities = 37/96 (38%), Positives = 58/96 (60%) Frame = +3 Query: 15 MSIHIKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDV 194 ++ H + + K + + KL+VIDF A+WC PC+ I P EMA + ++ +V K+DV Sbjct: 8 IACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTN-VVFFKIDV 66 Query: 195 DECEDIAAEYNINAMPTFVFVKATKKLEEFSGANVD 302 DE + +A E+ + AMPTFVF+K ++ GA D Sbjct: 67 DELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKD 102 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 79.8 bits (188), Expect = 1e-15 Identities = 36/86 (41%), Positives = 55/86 (63%) Frame = +3 Query: 36 FDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIA 215 FDDL + DK V++DF ATWCGPC+++ P L+E++ + D I V+K+D ++ +A Sbjct: 68 FDDLL----QNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLA 123 Query: 216 AEYNINAMPTFVFVKATKKLEEFSGA 293 +Y I A+PTF+ K K + F GA Sbjct: 124 NKYQIEALPTFILFKDGKLWDRFEGA 149 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 78.6 bits (185), Expect = 3e-15 Identities = 37/89 (41%), Positives = 55/89 (61%) Frame = +3 Query: 27 IKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECE 206 ++D+ + K + + KL+VIDF ATWC PC+ I P ++A + D +V KVDVDE Sbjct: 13 VEDWTE-KLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLD-VVFFKVDVDELN 70 Query: 207 DIAAEYNINAMPTFVFVKATKKLEEFSGA 293 +A E+ + AMPTF+F+K + E GA Sbjct: 71 TVAEEFKVQAMPTFIFMKEGEIKETVVGA 99 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 78.6 bits (185), Expect = 3e-15 Identities = 34/75 (45%), Positives = 53/75 (70%) Frame = +3 Query: 78 LVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFV 257 LVV+DF A+WCGPC+ I P ++A ++ + ++ LKVD DE + +A+++ I AMPTF+F+ Sbjct: 30 LVVVDFTASWCGPCRFIAPFFADLAKKLPN-VLFLKVDTDELKSVASDWAIQAMPTFMFL 88 Query: 258 KATKKLEEFSGANVD 302 K K L++ GA D Sbjct: 89 KEGKILDKVVGAKKD 103 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 77.4 bits (182), Expect = 6e-15 Identities = 34/86 (39%), Positives = 54/86 (62%) Frame = +3 Query: 36 FDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIA 215 FD + L + DK V++D+ ATWCGPC+ + P L+E++ + D I V+K+D ++ IA Sbjct: 70 FDSFEDLLVNS-DKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIA 128 Query: 216 AEYNINAMPTFVFVKATKKLEEFSGA 293 +Y I A+PTF+ K + + F GA Sbjct: 129 NKYKIEALPTFILFKDGEPCDRFEGA 154 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 76.2 bits (179), Expect = 1e-14 Identities = 34/80 (42%), Positives = 52/80 (65%) Frame = +3 Query: 63 EAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMP 242 + +KL+VIDF A WCGPCK + P++ E+A++ S++ V +VDVD D+A Y +P Sbjct: 40 KGSNKLLVIDFTAVWCGPCKAMEPRVREIASKYSEA-VFARVDVDRLMDVAGTYRAITLP 98 Query: 243 TFVFVKATKKLEEFSGANVD 302 FVFVK ++++ GA D Sbjct: 99 AFVFVKRGEEIDRVVGAKPD 118 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 75.4 bits (177), Expect = 3e-14 Identities = 37/92 (40%), Positives = 57/92 (61%) Frame = +3 Query: 21 IHIKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDE 200 I K+ D K ++ K+VV +F ATWCGPCK++ P E+ +E S++ L VDVDE Sbjct: 28 ITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIEL-SEKHSSLMFLLVDVDE 86 Query: 201 CEDIAAEYNINAMPTFVFVKATKKLEEFSGAN 296 D ++ ++I A PTF F+K +++ + GAN Sbjct: 87 LSDFSSSWDIKATPTFFFLKNGQQIGKLVGAN 118 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 70.9 bits (166), Expect = 6e-13 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 1/91 (1%) Frame = +3 Query: 33 DFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVD-ECED 209 D D + AGDK+VV+D WCGPCK+I PK E++ + D +V LK+D + + + Sbjct: 84 DKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQD-MVFLKLDCNQDNKP 142 Query: 210 IAAEYNINAMPTFVFVKATKKLEEFSGANVD 302 +A E I +PTF +K K ++E +GA + Sbjct: 143 LAKELGIRVVPTFKILKDNKVVKEVTGAKYE 173 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 70.5 bits (165), Expect = 7e-13 Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 1/91 (1%) Frame = +3 Query: 33 DFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVD-ECED 209 D D + AG+KLVV+D WCGPCK+I PK + +E D +V LK+D + + Sbjct: 74 DKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKAL-SEKYDDVVFLKLDCNPDNRP 132 Query: 210 IAAEYNINAMPTFVFVKATKKLEEFSGANVD 302 +A E I +PTF +K K ++E +GA D Sbjct: 133 LAKELGIRVVPTFKILKDNKVVKEVTGAKYD 163 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 68.1 bits (159), Expect = 4e-12 Identities = 34/90 (37%), Positives = 52/90 (57%), Gaps = 1/90 (1%) Frame = +3 Query: 21 IHIKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDE 200 I I + L +AGD+LV++DF TWCG C+ + PKL + A E +I+ LKV+ DE Sbjct: 96 IDITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKE-HPNILFLKVNFDE 154 Query: 201 CEDIAAEYNINAMPTFVFVK-ATKKLEEFS 287 + + N+ +P F F + A ++E FS Sbjct: 155 NKSLCKSLNVKVLPYFHFYRGADGQVESFS 184 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 65.7 bits (153), Expect = 2e-11 Identities = 34/90 (37%), Positives = 53/90 (58%), Gaps = 1/90 (1%) Frame = +3 Query: 21 IHIKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDE 200 + I ++ + LS AG++LV+++F TWC C+ + PKL + A E D IV LKV+ DE Sbjct: 106 VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPD-IVFLKVNFDE 164 Query: 201 CEDIAAEYNINAMPTFVFVK-ATKKLEEFS 287 + + N+ +P F F + A +LE FS Sbjct: 165 NKPMCKSLNVRVLPFFHFYRGADGQLESFS 194 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 65.7 bits (153), Expect = 2e-11 Identities = 34/90 (37%), Positives = 53/90 (58%), Gaps = 1/90 (1%) Frame = +3 Query: 21 IHIKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDE 200 + I ++ + LS AG++LV+++F TWC C+ + PKL + A E D IV LKV+ DE Sbjct: 106 VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPD-IVFLKVNFDE 164 Query: 201 CEDIAAEYNINAMPTFVFVK-ATKKLEEFS 287 + + N+ +P F F + A +LE FS Sbjct: 165 NKPMCKSLNVRVLPFFHFYRGADGQLESFS 194 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 65.3 bits (152), Expect = 3e-11 Identities = 28/82 (34%), Positives = 49/82 (59%) Frame = +3 Query: 48 KTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYN 227 +T++ E+ D V+++F A WCGPC+MI P +D++A + + K++ DE + A Y Sbjct: 97 QTKVLES-DVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYG 155 Query: 228 INAMPTFVFVKATKKLEEFSGA 293 I ++PT + K +K + GA Sbjct: 156 IRSVPTVIIFKGGEKKDSIIGA 177 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 65.3 bits (152), Expect = 3e-11 Identities = 23/65 (35%), Positives = 43/65 (66%) Frame = +3 Query: 81 VVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVK 260 V+++F+ATWCGPCK+I P ++ ++ E D + ++K+D D + AE+ + +P F+ K Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFK 149 Query: 261 ATKKL 275 K++ Sbjct: 150 DGKEV 154 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 62.1 bits (144), Expect = 3e-10 Identities = 26/65 (40%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = +3 Query: 81 VVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPT-FVFV 257 VV+DF A WCGPCKMI P ++++A + I K++ DE + +Y + ++PT +FV Sbjct: 101 VVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFV 160 Query: 258 KATKK 272 KK Sbjct: 161 GGEKK 165 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 60.9 bits (141), Expect = 6e-10 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +3 Query: 72 DKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPT-F 248 D+ V +DF A WCGPCKMI P ++E+A + + K++ DE +Y + ++PT Sbjct: 92 DEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATPGQYGVRSIPTIM 151 Query: 249 VFVKATKK 272 +FV KK Sbjct: 152 IFVNGEKK 159 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 60.5 bits (140), Expect = 8e-10 Identities = 29/98 (29%), Positives = 61/98 (62%), Gaps = 3/98 (3%) Frame = +3 Query: 12 KMSIH-IKDFDDLKTRLSEAGD--KLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVL 182 K +H + + + +++EA K++V++F A+WC P K I P E+A+ + S++ + Sbjct: 39 KGKVHPVSRMEKWEEKITEANSHGKILVVNFKASWCLPSKTILPIYQELASTYT-SMIFV 97 Query: 183 KVDVDECEDIAAEYNINAMPTFVFVKATKKLEEFSGAN 296 +DV+E + + E+N++A PT VF+K +++++ G + Sbjct: 98 TIDVEELAEFSHEWNVDATPTVVFLKDGRQMDKLVGGD 135 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 60.1 bits (139), Expect = 1e-09 Identities = 33/95 (34%), Positives = 52/95 (54%), Gaps = 4/95 (4%) Frame = +3 Query: 27 IKDFDDLKTRLSEAGDKLV--VIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDE 200 +K + + LS+A D + V F A WCGPC++I P + E++N+ D + KVD+DE Sbjct: 54 LKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPD-VTTYKVDIDE 112 Query: 201 --CEDIAAEYNINAMPTFVFVKATKKLEEFSGANV 299 + + N++A+PT F K K E G +V Sbjct: 113 GGLSNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDV 147 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/65 (35%), Positives = 41/65 (63%), Gaps = 2/65 (3%) Frame = +3 Query: 69 GDKLV--VIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMP 242 GD+ V ++DF ATWCGPC ++ +L+ +A E + +++KVD D+ + A + + +P Sbjct: 91 GDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLP 150 Query: 243 TFVFV 257 T F+ Sbjct: 151 TLFFI 155 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 58.8 bits (136), Expect = 2e-09 Identities = 33/95 (34%), Positives = 51/95 (53%), Gaps = 4/95 (4%) Frame = +3 Query: 27 IKDFDDLKTRLSEAGDKLV--VIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDE 200 +K ++ +S+A D + V F A WCGPC+ I P + E++ + D + KVD+DE Sbjct: 89 VKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPD-VTTYKVDIDE 147 Query: 201 --CEDIAAEYNINAMPTFVFVKATKKLEEFSGANV 299 + ++ NI A+PT F K K E GA+V Sbjct: 148 GGISNTISKLNITAVPTLHFFKGGSKKGEVVGADV 182 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 58.8 bits (136), Expect = 2e-09 Identities = 26/74 (35%), Positives = 45/74 (60%) Frame = +3 Query: 81 VVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVK 260 +V F A WC P + +E+A D++ ++ VDVDE +++A++ + AMPTF+F+K Sbjct: 27 IVAHFTALWCIPSVFMNSFFEELAFNYKDALFLI-VDVDEVKEVASQLEVKAMPTFLFLK 85 Query: 261 ATKKLEEFSGANVD 302 +++ GAN D Sbjct: 86 DGNAMDKLVGANPD 99 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 58.0 bits (134), Expect = 4e-09 Identities = 31/86 (36%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +3 Query: 42 DLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAE 221 DL L AGDKLVV+DF + CG CK + PK+ ++A E + + L+V+ +E + Sbjct: 103 DLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKIA-EKNPEVEFLQVNYEEHRSLCQS 161 Query: 222 YNINAMPTFVFVKATK-KLEEFSGAN 296 NI+ +P F F + + ++ FS N Sbjct: 162 LNIHVLPFFRFYRGSSGRVCSFSCTN 187 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 57.6 bits (133), Expect = 6e-09 Identities = 31/90 (34%), Positives = 53/90 (58%), Gaps = 1/90 (1%) Frame = +3 Query: 21 IHIKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDE 200 + I+ + L L AGD+LVV+DF + CG CK + PK+ ++A E + +++ LKV+ +E Sbjct: 88 LEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLA-ETNPNVMFLKVNQEE 146 Query: 201 CEDIAAEYNINAMPTFVFVK-ATKKLEEFS 287 + N++ +P F F + A K+ FS Sbjct: 147 LRTMCHGLNVHVLPFFKFYRGAEGKVCSFS 176 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 57.6 bits (133), Expect = 6e-09 Identities = 30/91 (32%), Positives = 52/91 (57%), Gaps = 1/91 (1%) Frame = +3 Query: 27 IKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECE 206 I +L L+ AGDKLVV+DF + CG CK + PK+ + A EM+ + L+V+ +E + Sbjct: 102 ISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQFA-EMNPDVQFLQVNYEEHK 160 Query: 207 DIAAEYNINAMPTFVFVKATK-KLEEFSGAN 296 + ++ +P F F + ++ ++ FS N Sbjct: 161 SMCYSLGVHVLPFFRFYRGSQGRVCSFSCTN 191 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 54.8 bits (126), Expect = 4e-08 Identities = 24/65 (36%), Positives = 41/65 (63%) Frame = +3 Query: 99 ATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVKATKKLE 278 A WC PCK I P ++A+ S++ + VDV+E + + E+N+ A PT VF+K ++++ Sbjct: 17 APWCVPCKKIEPVFRDLASRYP-SMIFVTVDVEELAEFSNEWNVEATPTVVFLKDGRQMD 75 Query: 279 EFSGA 293 + GA Sbjct: 76 KLVGA 80 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 54.4 bits (125), Expect = 5e-08 Identities = 21/62 (33%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +3 Query: 72 DKLVVIDFMATWCGPCKMIGPKLDEMANEM-SDSIVVLKVDVDECEDIAAEYNINAMPTF 248 ++ V+++F A WCG C+ + P+ A E+ D +V+ K+D E ++A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 249 VF 254 +F Sbjct: 180 LF 181 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = +3 Query: 75 KLVVIDFMATWCGPCKMIGPKLDEMANEMS--DSIVVLKVDVDECEDIAAEYNINAMPTF 248 K V+++ A WCG C+ + P +++A + DS+V+ K+D E A+ PT Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAK--AEGFPTI 517 Query: 249 VFVKATKKLEE 281 +F A K E Sbjct: 518 LFFPAGNKTSE 528 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 54.4 bits (125), Expect = 5e-08 Identities = 21/62 (33%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +3 Query: 72 DKLVVIDFMATWCGPCKMIGPKLDEMANEM-SDSIVVLKVDVDECEDIAAEYNINAMPTF 248 ++ V+++F A WCG C+ + P+ A E+ D +V+ K+D E ++A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 249 VF 254 +F Sbjct: 180 LF 181 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = +3 Query: 75 KLVVIDFMATWCGPCKMIGPKLDEMANEMS--DSIVVLKVDVDECEDIAAEYNINAMPTF 248 K V+++ A WCG C+ + P +++A + DS+V+ K+D E A+ PT Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAK--AEGFPTI 517 Query: 249 VFVKATKKLEE 281 +F A K E Sbjct: 518 LFFPAGNKTSE 528 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 54.0 bits (124), Expect = 7e-08 Identities = 22/70 (31%), Positives = 39/70 (55%) Frame = +3 Query: 81 VVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVK 260 V+++F +WCGPC+M+ +DE+A + + + ++ D +A EY I A+P + K Sbjct: 87 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFK 146 Query: 261 ATKKLEEFSG 290 +K E G Sbjct: 147 NGEKRESIMG 156 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 52.8 bits (121), Expect = 2e-07 Identities = 22/76 (28%), Positives = 46/76 (60%), Gaps = 3/76 (3%) Frame = +3 Query: 72 DKLVVIDFMATWCGPCKMIGPKLDEM--ANEMSDSIVVLKVDVDECEDIAAEYNINAMPT 245 DK +++F A WCG CK + P+ +++ + + + S+++ KVD DE + + +Y ++ PT Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPT 99 Query: 246 FV-FVKATKKLEEFSG 290 F K + + +++ G Sbjct: 100 IQWFPKGSLEPQKYEG 115 Score = 48.4 bits (110), Expect = 3e-06 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 3/76 (3%) Frame = +3 Query: 72 DKLVVIDFMATWCGPCKMIGPKLDEMAN--EMSDSIVVLKVDVDECEDIAAEYNINAMPT 245 +K V+++F A WCG CK + P +++A + + +V+ +D D + + +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 246 F-VFVKATKKLEEFSG 290 F K K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 52.8 bits (121), Expect = 2e-07 Identities = 22/76 (28%), Positives = 46/76 (60%), Gaps = 3/76 (3%) Frame = +3 Query: 72 DKLVVIDFMATWCGPCKMIGPKLDEM--ANEMSDSIVVLKVDVDECEDIAAEYNINAMPT 245 DK +++F A WCG CK + P+ +++ + + + S+++ KVD DE + + +Y ++ PT Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPT 99 Query: 246 FV-FVKATKKLEEFSG 290 F K + + +++ G Sbjct: 100 IQWFPKGSLEPQKYEG 115 Score = 48.4 bits (110), Expect = 3e-06 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 3/76 (3%) Frame = +3 Query: 72 DKLVVIDFMATWCGPCKMIGPKLDEMAN--EMSDSIVVLKVDVDECEDIAAEYNINAMPT 245 +K V+++F A WCG CK + P +++A + + +V+ +D D + + +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 246 F-VFVKATKKLEEFSG 290 F K K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 52.4 bits (120), Expect = 2e-07 Identities = 23/76 (30%), Positives = 44/76 (57%), Gaps = 6/76 (7%) Frame = +3 Query: 81 VVIDFMATWCGPCKMIGPKLDEMANEMSDS---IVVLKVDVDE--CEDIAAEYNINAMPT 245 +V++F A WCG CK + P+ ++ A+ +S + +V+ K+D E + A +Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 246 F-VFVKATKKLEEFSG 290 +F K ++E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 47.6 bits (108), Expect = 6e-06 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 2/74 (2%) Frame = +3 Query: 75 KLVVIDFMATWCGPCKMIGPKLDEMA-NEMSD-SIVVLKVDVDECEDIAAEYNINAMPTF 248 K V+++F A WCG C+ + P LDE+A + SD S+V+ K+D + +++ PT Sbjct: 393 KNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTI 452 Query: 249 VFVKATKKLEEFSG 290 F A+ + + G Sbjct: 453 YFKSASGNVVVYEG 466 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 52.4 bits (120), Expect = 2e-07 Identities = 23/76 (30%), Positives = 44/76 (57%), Gaps = 6/76 (7%) Frame = +3 Query: 81 VVIDFMATWCGPCKMIGPKLDEMANEMSDS---IVVLKVDVDE--CEDIAAEYNINAMPT 245 +V++F A WCG CK + P+ ++ A+ +S + +V+ K+D E + A +Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 246 F-VFVKATKKLEEFSG 290 +F K ++E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 47.6 bits (108), Expect = 6e-06 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 2/74 (2%) Frame = +3 Query: 75 KLVVIDFMATWCGPCKMIGPKLDEMA-NEMSD-SIVVLKVDVDECEDIAAEYNINAMPTF 248 K V+++F A WCG C+ + P LDE+A + SD S+V+ K+D + +++ PT Sbjct: 393 KNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTI 452 Query: 249 VFVKATKKLEEFSG 290 F A+ + + G Sbjct: 453 YFKSASGNVVVYEG 466 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 51.2 bits (117), Expect = 5e-07 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +3 Query: 78 LVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTF-VF 254 +V+++F A WCG CK + P +++AN + V +D D + A +Y I PT VF Sbjct: 50 VVLVEFFAPWCGHCKALTPTWEKVANILKGVATVAAIDADAHQSAAQDYGIKGFPTIKVF 109 Query: 255 VKATKKLEEFSGA 293 V + ++ GA Sbjct: 110 VPGKAPI-DYQGA 121 Score = 45.2 bits (102), Expect = 3e-05 Identities = 20/79 (25%), Positives = 39/79 (49%) Frame = +3 Query: 15 MSIHIKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDV 194 + ++ +FDDL +E L +++F A WCG CK + P+ A + + + V+ Sbjct: 165 VELNASNFDDLVIESNE----LWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKLGHVNC 220 Query: 195 DECEDIAAEYNINAMPTFV 251 D + I + + + PT + Sbjct: 221 DVEQSIMSRFKVQGFPTIL 239 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 50.4 bits (115), Expect = 8e-07 Identities = 29/85 (34%), Positives = 46/85 (54%) Frame = +3 Query: 39 DDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAA 218 DD+K+ S A VI++ A+WCG C I P +++N S + + D+DEC + Sbjct: 37 DDIKSSKSPA-----VINYGASWCGVCSQILPAFRKLSNSFS-KLKFVYADIDECPETTR 90 Query: 219 EYNINAMPTFVFVKATKKLEEFSGA 293 +I PTF F + +K++E GA Sbjct: 91 --HIRYTPTFQFYRDGEKVDEMFGA 113 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 50.4 bits (115), Expect = 8e-07 Identities = 21/70 (30%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Frame = +3 Query: 60 SEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDE---CEDIAAEYNI 230 + G KL+V+D CGPC + P + +++ MS+++V +++ DE C + + N+ Sbjct: 203 NRTGGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFARMNGDENDSCMEFLKDMNV 262 Query: 231 NAMPTFVFVK 260 +PTF+F++ Sbjct: 263 IEVPTFLFIR 272 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 3/77 (3%) Frame = +3 Query: 81 VVIDFMATWCGPCKMIGPKLDEMA---NEMSDSIVVLKVDVDECEDIAAEYNINAMPTFV 251 + +DF A WCG CK + P+LD A ++ IV+ K++ D+ +A + I+A PT + Sbjct: 52 IFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLM 111 Query: 252 FVKATKKLEEFSGANVD 302 +E + D Sbjct: 112 LYNHGVPMEYYGPRKAD 128 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 49.2 bits (112), Expect = 2e-06 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = +3 Query: 72 DKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPT-F 248 + +++F A WCG C+ + P+ A E+ + K+D E D+A +Y I PT F Sbjct: 116 NSFAMVEFYAPWCGACQALTPEYAAAATELKGLAALAKIDATEEGDLAQKYEIQGFPTVF 175 Query: 249 VFV 257 +FV Sbjct: 176 LFV 178 Score = 35.1 bits (77), Expect = 0.034 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 2/92 (2%) Frame = +3 Query: 33 DFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMS--DSIVVLKVDVDECE 206 +FD++ L E+ D V+++ A WCG C+ P +++ + DS+VV K+D E Sbjct: 446 NFDEIV--LDESKD--VLLEIYAPWCGHCQSFEPIYNKLGKYLKGIDSLVVAKMDGTSNE 501 Query: 207 DIAAEYNINAMPTFVFVKATKKLEEFSGANVD 302 A+ + PT +F K + +VD Sbjct: 502 HPRAK--ADGFPTILFFPGGNKSFDPIAVDVD 531 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 48.8 bits (111), Expect = 3e-06 Identities = 22/85 (25%), Positives = 43/85 (50%) Frame = +3 Query: 15 MSIHIKDFDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDV 194 + ++ +FD+L T E L +++F A WCG CK + P+ + AN + + + V+ Sbjct: 166 VELNSSNFDELVTESKE----LWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVNC 221 Query: 195 DECEDIAAEYNINAMPTFVFVKATK 269 D + I + + + PT + + K Sbjct: 222 DAEQSIKSRFKVQGFPTILVFGSDK 246 Score = 48.0 bits (109), Expect = 5e-06 Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +3 Query: 78 LVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTF-VF 254 +V+++F A WCG C+ + P +++A+ + V +D D + ++ +Y + PT VF Sbjct: 48 VVLVEFFAPWCGHCQSLTPTWEKVASTLKGIATVAAIDADAHKSVSQDYGVRGFPTIKVF 107 Query: 255 VKATKKLEEFSGA 293 V + ++ GA Sbjct: 108 VPGKPPI-DYQGA 119 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 48.4 bits (110), Expect = 3e-06 Identities = 22/76 (28%), Positives = 44/76 (57%), Gaps = 6/76 (7%) Frame = +3 Query: 81 VVIDFMATWCGPCKMIGPKLDEMANEMSD---SIVVLKVDVDE--CEDIAAEYNINAMPT 245 +V++F A WCG C+ + P+ ++ A+E+S + + K+D E ++ A EY I PT Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPT 108 Query: 246 FVFVK-ATKKLEEFSG 290 ++ K +++++G Sbjct: 109 LKILRNGGKSVQDYNG 124 Score = 47.6 bits (108), Expect = 6e-06 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 2/74 (2%) Frame = +3 Query: 75 KLVVIDFMATWCGPCKMIGPKLDEMANEMSD--SIVVLKVDVDECEDIAAEYNINAMPTF 248 K V+I+F A WCG C+ + P LDE+A + S+++ K+D + + +++ PT Sbjct: 391 KNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSVIIAKLDATANDIPSDTFDVKGFPTI 450 Query: 249 VFVKATKKLEEFSG 290 F A+ + + G Sbjct: 451 YFRSASGNVVVYEG 464 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 48.0 bits (109), Expect = 5e-06 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 3/93 (3%) Frame = +3 Query: 27 IKDFDDLKTRLSEAGD--KLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDE 200 I + ++L LS A + ++I++MA+WC C + PKL+++A E ++ VDV++ Sbjct: 101 INNVEELDAVLSHARQLSQPIIIEWMASWCRKCIYLKPKLEKLAAEYNNRAKFYYVDVNK 160 Query: 201 C-EDIAAEYNINAMPTFVFVKATKKLEEFSGAN 296 + + NI+ MPT K + EE G + Sbjct: 161 VPQTLVKRGNISKMPTIQLWKEDEMKEEVIGGH 193 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 46.8 bits (106), Expect = 1e-05 Identities = 19/82 (23%), Positives = 44/82 (53%) Frame = +3 Query: 54 RLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNIN 233 +L +++++ + + CGPC+ + P L+++ +E + + +++D++E ++IA I Sbjct: 436 KLYHESPRVILVLYTSPTCGPCRTLKPILNKVVDEYNHDVHFVEIDIEEDQEIAEAAGIM 495 Query: 234 AMPTFVFVKATKKLEEFSGANV 299 P F K + L SG + Sbjct: 496 GTPCVQFFKNKEMLRTISGVKM 517 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 44.8 bits (101), Expect = 4e-05 Identities = 28/83 (33%), Positives = 41/83 (49%), Gaps = 7/83 (8%) Frame = +3 Query: 60 SEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDS---IVVLKVDV----DECEDIAA 218 S+ + LVV+DF T CG CK I ++ + D ++ LK +V DE ++A Sbjct: 116 SKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSEVAE 175 Query: 219 EYNINAMPTFVFVKATKKLEEFS 287 I A+P F F K LE F+ Sbjct: 176 RLRIKAVPLFHFYKNGVLLESFA 198 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 44.8 bits (101), Expect = 4e-05 Identities = 28/83 (33%), Positives = 41/83 (49%), Gaps = 7/83 (8%) Frame = +3 Query: 60 SEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDS---IVVLKVDV----DECEDIAA 218 S+ + LVV+DF T CG CK I ++ + D ++ LK +V DE ++A Sbjct: 103 SKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSEVAE 162 Query: 219 EYNINAMPTFVFVKATKKLEEFS 287 I A+P F F K LE F+ Sbjct: 163 RLRIKAVPLFHFYKNGVLLESFA 185 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 44.4 bits (100), Expect = 6e-05 Identities = 20/72 (27%), Positives = 40/72 (55%) Frame = +3 Query: 81 VVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVK 260 V++ F A WCGPC+ + P L++M +E + V+ D ++I+ +PT + K Sbjct: 230 VMVMFTARWCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDISYLPTTLVFK 289 Query: 261 ATKKLEEFSGAN 296 +++ + +GA+ Sbjct: 290 GGEQMAKVTGAD 301 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 43.2 bits (97), Expect = 1e-04 Identities = 21/72 (29%), Positives = 38/72 (52%) Frame = +3 Query: 81 VVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVK 260 VV+ F A+WC K + +A + + +V+ +E +I+ Y++ A+P FVF K Sbjct: 24 VVLHFWASWCDASKQMDQVFSHLATDFPRAHF-FRVEAEEHPEISEAYSVAAVPYFVFFK 82 Query: 261 ATKKLEEFSGAN 296 K ++ GA+ Sbjct: 83 DGKTVDTLEGAD 94 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 41.1 bits (92), Expect = 5e-04 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 1/88 (1%) Frame = +3 Query: 36 FDDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECE-DI 212 FD + + G+ +V++ +MA WC C + PKL+++A E + VDV+ + Sbjct: 87 FDQVMEDAQKLGESVVIV-WMAAWCRKCIYLKPKLEKLAAEFYPRLRFYHVDVNAVPYRL 145 Query: 213 AAEYNINAMPTFVFVKATKKLEEFSGAN 296 + + MPT + +K E G + Sbjct: 146 VSRAGVTKMPTIQLWRDGQKQAEVIGGH 173 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 40.7 bits (91), Expect = 7e-04 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +3 Query: 75 KLVVIDFMATWCGPCKMIGPKLDEMANEMSDSI--VVLKVDVDECEDIAAEY 224 K + + F A WCGPC+ P+L E+ NE+S + ++ V DE E+ +Y Sbjct: 44 KKIGLYFSAAWCGPCQRFTPQLVEVYNELSSKVGFEIVFVSGDEDEESFGDY 95 Score = 35.5 bits (78), Expect = 0.026 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Frame = +3 Query: 39 DDLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEM---ANEMSDSIVVLKVDVDECED 209 D K +S+ K +++ F A WC PC+ PKL E+ E +++ ++ + D ++ Sbjct: 352 DGAKVLVSDLVGKTILMYFSAHWCPPCRAFTPKLVEVYKQIKERNEAFELIFISSDRDQE 411 Query: 210 IAAEY 224 EY Sbjct: 412 SFDEY 416 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/66 (33%), Positives = 31/66 (46%) Frame = +3 Query: 84 VIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVKA 263 VI F CK I P +D + SI LKVD+D+C I N+ +PT K Sbjct: 617 VIHFSTASDHQCKQISPFVDSLCTRYP-SIHFLKVDIDKCPSIGNAENVRVVPTVKIYKN 675 Query: 264 TKKLEE 281 +++E Sbjct: 676 GSRVKE 681 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 4/70 (5%) Frame = +3 Query: 69 GDKLVVIDFMATWCGPCKMIGPKLDEMAN---EMSDSIVVLKVDVDECEDIAAEYNINAM 239 G++ V++ A WC + P+ E A E+ S+++ K+D D IA+E I Sbjct: 93 GNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSVLMAKIDGDRYSKIASELEIKGF 152 Query: 240 PT-FVFVKAT 266 PT +FV T Sbjct: 153 PTLLLFVNGT 162 >At4g12170.1 68417.m01934 thioredoxin family protein similar to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 128 Score = 36.7 bits (81), Expect = 0.011 Identities = 19/70 (27%), Positives = 34/70 (48%) Frame = +3 Query: 81 VVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVK 260 V++ F+A C C + P+L+ + +E + VD DE ++A +Y I P + K Sbjct: 45 VIVVFIAKDCAECGSLMPELEFLDSEYEYMLKFYTVDTDEELELAKDYRIEYHPITIVFK 104 Query: 261 ATKKLEEFSG 290 ++ E G Sbjct: 105 GGEEKERVLG 114 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 36.3 bits (80), Expect = 0.015 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 4/81 (4%) Frame = +3 Query: 42 DLKTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSD---SIVVLKVDVDECEDI 212 D RL + + ++V+ + A WC + P+ E A ++ + S+++ K+D + + Sbjct: 83 DNTKRLIDGNEYVMVLGY-APWCARSAELMPRFAEAATDLKEIGSSVLMAKIDGERYSKV 141 Query: 213 AAEYNINAMPT-FVFVKATKK 272 A++ I PT +FV T + Sbjct: 142 ASQLEIKGFPTLLLFVNGTSQ 162 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 36.3 bits (80), Expect = 0.015 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = +3 Query: 87 IDFMATWCGPCKMIGPKLDEM--ANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVK 260 + F WC CK +G +++ A E D I V +VD + + I++ PTF+ Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 261 ATKKLEEFSG 290 +++ ++ G Sbjct: 108 NGEEVSKYKG 117 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 36.3 bits (80), Expect = 0.015 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = +3 Query: 87 IDFMATWCGPCKMIGPKLDEM--ANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVK 260 + F WC CK +G +++ A E D I V +VD + + I++ PTF+ Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 261 ATKKLEEFSG 290 +++ ++ G Sbjct: 108 NGEEVSKYKG 117 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 36.3 bits (80), Expect = 0.015 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = +3 Query: 87 IDFMATWCGPCKMIGPKLDEM--ANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVK 260 + F WC CK +G +++ A E D I V +VD + + I++ PTF+ Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 261 ATKKLEEFSG 290 +++ ++ G Sbjct: 108 NGEEVSKYKG 117 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 35.1 bits (77), Expect = 0.034 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 7/68 (10%) Frame = +3 Query: 60 SEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDS---IVVLKVDV----DECEDIAA 218 S+ + LVV+DF T CG CK I ++ + D ++ LK +V DE ++A Sbjct: 103 SKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSEVAE 162 Query: 219 EYNINAMP 242 I +P Sbjct: 163 RLRIKVIP 170 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 34.7 bits (76), Expect = 0.045 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = +3 Query: 33 DFDDL-KTRLSEAGDKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDEC-E 206 D D L + S+ G+ + + F A+WC + + PK D M + M I L V+ + Sbjct: 60 DGDSLDRLMASQHGNAYMSVLFYASWCPFSRAVRPKFD-MLSSMFPQIQHLAVEHSQALP 118 Query: 207 DIAAEYNINAMPTFVFVKAT 266 + + Y I+++P+ + V T Sbjct: 119 SVFSRYGIHSLPSILMVNQT 138 >At5g08290.1 68418.m00976 yellow-leaf-specific protein 8 (YLS8) / mitosis protein DIM1, putative contains Pfam domain PF02966: Mitosis protein DIM1; identical to cDNA YLS8 mRNA for Dim1 homolog GI:13122293 Length = 142 Score = 31.5 bits (68), Expect = 0.42 Identities = 18/68 (26%), Positives = 29/68 (42%) Frame = +3 Query: 72 DKLVVIDFMATWCGPCKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFV 251 ++LVVI F W C + L +A + + V+ VD+ E D Y + T + Sbjct: 23 ERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVM 82 Query: 252 FVKATKKL 275 F K + Sbjct: 83 FFFRNKHI 90 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 31.1 bits (67), Expect = 0.56 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +3 Query: 84 VIDFMATWCGPCKMIGPKLDEMANEMSDS---IVVLKVDVDECEDIAAEYNINAMPT-FV 251 ++ A WC C+ + DE+A++++ S + + D D+ E E + + PT V Sbjct: 377 IVVLYAPWCPFCQAMEASYDELADKLAGSGIKVAKFRADGDQKEFAKQELQLGSFPTILV 436 Query: 252 FVKATKK 272 F K + + Sbjct: 437 FPKNSSR 443 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/67 (23%), Positives = 32/67 (47%), Gaps = 4/67 (5%) Frame = +3 Query: 84 VIDFMATWCGPCKMIGPKLDEMANEMSDS---IVVLKVDVDECEDIAAEYNINAMPT-FV 251 ++ A WC C+ + DE+A+++ S + + D D+ + E + + PT V Sbjct: 370 IVVLYAPWCPFCQAMEASFDELADKLGGSGVKVAKFRADGDQKDFAKKELQLGSFPTILV 429 Query: 252 FVKATKK 272 F K + + Sbjct: 430 FPKNSSR 436 >At4g31240.2 68417.m04435 expressed protein Length = 392 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 75 KLVVIDFMATWCGPCKMIGPKLDEMANEMSD 167 K + + F A WC PCK P+L ++ + + Sbjct: 44 KTICLFFSAIWCRPCKDFTPELIKLYENLQN 74 >At4g31240.1 68417.m04434 expressed protein Length = 392 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 75 KLVVIDFMATWCGPCKMIGPKLDEMANEMSD 167 K + + F A WC PCK P+L ++ + + Sbjct: 44 KTICLFFSAIWCRPCKDFTPELIKLYENLQN 74 >At1g64290.1 68414.m07285 F-box protein-related contains TIGRFAM TIGR01640 : F-box protein interaction domain; Length = 364 Score = 27.9 bits (59), Expect = 5.2 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -3 Query: 200 FVNVDLKNNNGV-GHFVSHLVEFGPDHLAGSAPSRHEVNHDELVARLRQPGLQVIEVLD 27 FVN++L N + G+F+ H + G + R ++ ++ + PG+ IE D Sbjct: 42 FVNLNLLRTNRISGYFIQHYIVKGHELRTSFVHERSDLQNNGVSIDFLPPGMIKIEACD 100 >At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 721 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +3 Query: 117 CKMIGPKLDEMANEMSDSIVVLKVDVDECEDIAAEYNINAMPTFVFVKATKKLEE 281 CK I +D + S+ LKV++ +C ++ + +PTF K +++E Sbjct: 650 CKEISTFVDALCVRYP-SLHFLKVEIVKCPEVGNAERVRVVPTFKIYKLGIRMKE 703 >At3g07330.1 68416.m00874 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 682 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 275 EFLGRLNKHESRHRVDVIFGGDVFAFVNVDLK 180 EF NK R+ DV++ GD AF+ V+++ Sbjct: 8 EFQQWWNKQRDRNNHDVLYAGDDEAFLTVEIR 39 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -2 Query: 135 WARSSCRVRTKSP*SQSRRACRPPPTAWSSSHRSP 31 + R S R +SP RR+ PPP S RSP Sbjct: 141 YGRRSYSPRARSPPPPRRRSPSPPPARGRSYSRSP 175 >At4g31040.1 68417.m04408 proton extrusion protein-related contains weak similarity to Proton extrusion protein pcxA (Swiss-Prot:P75028) [Synechocystis sp.] Length = 438 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = -3 Query: 308 EXVDVRAGELFEFLGRLNKHESRHRVDVIFG 216 + +DVR + E + LN+ ++R+R++V G Sbjct: 252 QTLDVRRNQKLEMVKELNREKARYRLEVEIG 282 >At4g03415.1 68417.m00468 protein phosphatase 2C family protein / PP2C family protein similar to protein phosphatase-2C; PP2C (GI:3643088) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain; Length = 453 Score = 27.1 bits (57), Expect = 9.0 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = -2 Query: 510 FSSHIVFTRTLTSVNY*MKSNKKAFSRLVFTYCFGKQIKGIN 385 FS HIV + LTS+ + S+ K+ S +FT + KGIN Sbjct: 42 FSDHIVSLQNLTSIPNRITSSSKSRSSCIFTQ---QGRKGIN 80 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 183 KVDVDECEDIAAEYNINAMPTFVFVKATKKLEE 281 KVDV+E +A +I +PTF K +K++E Sbjct: 632 KVDVEESLALAKAESIKKIPTFKIYKKGEKVKE 664 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,745,090 Number of Sequences: 28952 Number of extensions: 196853 Number of successful extensions: 646 Number of sequences better than 10.0: 72 Number of HSP's better than 10.0 without gapping: 606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -