BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_H20 (448 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 1.2 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 1.2 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 25 1.2 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 25 1.2 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 25 1.2 CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 25 1.6 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 25 1.6 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 24 2.8 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 3.7 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 23 6.5 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 23 6.5 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 22 8.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 22 8.6 AF203339-1|AAF19834.1| 156|Anopheles gambiae immune-responsive ... 22 8.6 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.0 bits (52), Expect = 1.2 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 68 YNQMPFHPEHHHNRLRSP 121 ++Q+P HP H H+ + P Sbjct: 100 HHQLPHHPHHQHHPQQQP 117 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.0 bits (52), Expect = 1.2 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 68 YNQMPFHPEHHHNRLRSP 121 ++Q+P HP H H+ + P Sbjct: 100 HHQLPHHPHHQHHPQQQP 117 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 25.0 bits (52), Expect = 1.2 Identities = 29/101 (28%), Positives = 40/101 (39%), Gaps = 5/101 (4%) Frame = +2 Query: 86 HPEHHHNRLRSPY----FGEDVFDTGRFWSELS-SELRELDNMLADFYRKFPTPASSSQG 250 H HHH R R Y FG ++ + F S+ S S + +L+ + T S Sbjct: 30 HSRHHHRRRRERYRSQRFGYEIQNVDEFLSKCSLSSPGNIPVVLSSAATLYQTRPGS--- 86 Query: 251 IEGNEYKVTIPLTSFDEKDIVVKARTGLLMVQAVHKYEGDV 373 Y++ IPL + V K L VQ H EG V Sbjct: 87 -----YQIEIPLPLGMVVNAVFK-NQNWLYVQTPHAEEGYV 121 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 25.0 bits (52), Expect = 1.2 Identities = 29/101 (28%), Positives = 40/101 (39%), Gaps = 5/101 (4%) Frame = +2 Query: 86 HPEHHHNRLRSPY----FGEDVFDTGRFWSELS-SELRELDNMLADFYRKFPTPASSSQG 250 H HHH R R Y FG ++ + F S+ S S + +L+ + T S Sbjct: 30 HSRHHHRRRRERYRSQRFGYEIQNVDEFLSKCSLSSPGNIPVVLSSAATLYQTRPGS--- 86 Query: 251 IEGNEYKVTIPLTSFDEKDIVVKARTGLLMVQAVHKYEGDV 373 Y++ IPL + V K L VQ H EG V Sbjct: 87 -----YQIEIPLPLGMVVNAVFK-NQNWLYVQTPHAEEGYV 121 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 25.0 bits (52), Expect = 1.2 Identities = 29/101 (28%), Positives = 40/101 (39%), Gaps = 5/101 (4%) Frame = +2 Query: 86 HPEHHHNRLRSPY----FGEDVFDTGRFWSELS-SELRELDNMLADFYRKFPTPASSSQG 250 H HHH R R Y FG ++ + F S+ S S + +L+ + T S Sbjct: 30 HSRHHHRRRRERYRSQRFGYEIQNVDEFLSKCSLSSPGNIPVVLSSAATLYQTRPGS--- 86 Query: 251 IEGNEYKVTIPLTSFDEKDIVVKARTGLLMVQAVHKYEGDV 373 Y++ IPL + V K L VQ H EG V Sbjct: 87 -----YQIEIPLPLGMVVNAVFK-NQNWLYVQTPHAEEGYV 121 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 24.6 bits (51), Expect = 1.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 215 RKFPTPASSSQGIEGNEYKVTIPLTSFDEKDI 310 R FP+ +SSQ + +V P F DI Sbjct: 13 RSFPSTGTSSQSVVSIVLRVPFPANRFQPDDI 44 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 24.6 bits (51), Expect = 1.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 215 RKFPTPASSSQGIEGNEYKVTIPLTSFDEKDI 310 R FP+ +SSQ + +V P F DI Sbjct: 13 RSFPSTGTSSQSVVSIVLRVPFPANRFQPDDI 44 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.8 bits (49), Expect = 2.8 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 206 DFYRKFPTPASSSQGIEGNEYKVTIPLTSFDE 301 DF++K+P P + + G+ + + SF E Sbjct: 27 DFFKKYPIPCLPVEPLFGSSRQFLLKKISFSE 58 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.4 bits (48), Expect = 3.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 77 MPFHPEHHHNRLRSP 121 +P+H +HHN SP Sbjct: 454 LPYHDHNHHNSPMSP 468 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 22.6 bits (46), Expect = 6.5 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +2 Query: 92 EHHHNRLRSPYFGEDVFDTGRFWSELSSE 178 +H R + FG D G +WS +E Sbjct: 29 QHTSRRFKDESFGHDQTPAGSWWSSHLTE 57 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 22.6 bits (46), Expect = 6.5 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +2 Query: 92 EHHHNRLRSPYFGEDVFDTGRFWSELSSE 178 +H R + FG D G +WS +E Sbjct: 29 QHTSRRFKDESFGHDQTPAGSWWSSHLTE 57 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 22.2 bits (45), Expect = 8.6 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -2 Query: 87 WKGIWLYPIP 58 +KG+W YP P Sbjct: 197 FKGLWTYPFP 206 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.2 bits (45), Expect = 8.6 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 86 HPEHHHN 106 HP HHHN Sbjct: 1402 HPHHHHN 1408 >AF203339-1|AAF19834.1| 156|Anopheles gambiae immune-responsive serpin-related proteinISerpF1 protein. Length = 156 Score = 22.2 bits (45), Expect = 8.6 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -2 Query: 87 WKGIWLYPIP 58 +KG+W YP P Sbjct: 98 FKGLWTYPFP 107 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 497,405 Number of Sequences: 2352 Number of extensions: 10036 Number of successful extensions: 39 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -