BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_H10 (529 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25940.1 68417.m03731 epsin N-terminal homology (ENTH) domain... 29 1.5 At5g57200.1 68418.m07145 epsin N-terminal homology (ENTH) domain... 29 1.9 At1g13260.1 68414.m01539 DNA-binding protein RAV1 (RAV1) identic... 28 4.5 At1g64290.1 68414.m07285 F-box protein-related contains TIGRFAM ... 27 5.9 >At4g25940.1 68417.m03731 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Chain B, Crystal Structure Of N-Terminal Domain Of Drosophila Ap180 (GP:13399617) [Drosophila melanogaster]; supporting cDNA gi|20465326|gb|AY096427.1| Length = 601 Score = 29.5 bits (63), Expect = 1.5 Identities = 35/132 (26%), Positives = 59/132 (44%), Gaps = 14/132 (10%) Frame = +2 Query: 17 WQENADLYEEEVTKDYQ-RSYEIVARHV---LGAAPKPFD---KHTFMPSALDFYQTALR 175 W L+ EE + Y+ Y+I A + GA+ K D T+ L + + Sbjct: 139 WIRTYALFLEERLECYRVLKYDIEAERLPKGSGASSKNVDFNASQTYRTRMLSDEELLEQ 198 Query: 176 DPAFYQLYNRIVGYI---NAFKHYLKPYPQE---KLHF-VGVKINDVVVEKLVTFFDYSQ 334 PA QL R++G +A+ +YL Y K F + IND ++ + FF+ S+ Sbjct: 199 LPALQQLLYRLIGCQPEGSAYSNYLIQYALALVLKESFKIYCAINDGIINLVDMFFEMSR 258 Query: 335 FDATNSVFLTKK 370 DA ++ + K+ Sbjct: 259 HDAVKALNIYKR 270 >At5g57200.1 68418.m07145 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related low similarity to clathrin assembly protein AP180 [Xenopus laevis] GI:6492344; contains Pfam profile PF01417: ENTH domain Length = 591 Score = 29.1 bits (62), Expect = 1.9 Identities = 35/127 (27%), Positives = 56/127 (44%), Gaps = 9/127 (7%) Frame = +2 Query: 17 WQENADLYEEEVTKDYQ-RSYEIVARHVLGAAPKPFDKH-TFMPSALDFYQTALRDPAFY 190 W L+ EE + Y+ Y+I A + A+ H T M S D + PA Sbjct: 139 WVRTYALFLEERLECYRVLKYDIEAERLPKASGAASKTHRTRMLSGEDLLEQL---PALQ 195 Query: 191 QLYNRIVGYIN---AFKHYLKPYPQE---KLHF-VGVKINDVVVEKLVTFFDYSQFDATN 349 QL R++G A+ +YL Y K F + IND ++ + FF+ S+ DA Sbjct: 196 QLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGIINLVDMFFEMSRHDAVK 255 Query: 350 SVFLTKK 370 ++ + K+ Sbjct: 256 ALNIYKR 262 >At1g13260.1 68414.m01539 DNA-binding protein RAV1 (RAV1) identical to SP|Q9ZWM9 DNA-binding protein RAV1 {Arabidopsis thaliana}, RAV1 GI:3868857 from [Arabidopsis thaliana] Length = 344 Score = 27.9 bits (59), Expect = 4.5 Identities = 21/75 (28%), Positives = 35/75 (46%) Frame = +2 Query: 143 SALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFF 322 SA ++ A+ +L ++ +A KH+ P P + GV +N V V F Sbjct: 183 SAEALFEKAVTPSDVGKLNRLVIPKHHAEKHF--PLPSSNVSVKGVLLNFEDVNGKVWRF 240 Query: 323 DYSQFDATNSVFLTK 367 YS ++++ S LTK Sbjct: 241 RYSYWNSSQSYVLTK 255 >At1g64290.1 68414.m07285 F-box protein-related contains TIGRFAM TIGR01640 : F-box protein interaction domain; Length = 364 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = -1 Query: 421 ESWLTNLEVVWVTSLNLFFGQEYTVSG--IKLAIVKECD*FLNDNI-IDF 281 ESW NL ++ ++ +F Q Y V G ++ + V E N+ + IDF Sbjct: 39 ESWFVNLNLLRTNRISGYFIQHYIVKGHELRTSFVHERSDLQNNGVSIDF 88 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,798,248 Number of Sequences: 28952 Number of extensions: 214205 Number of successful extensions: 609 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -