BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_H09 (633 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0138 + 11710595-11711271,11711533-11711665,11711819-117119... 28 5.4 04_01_0239 - 3126367-3127230,3127342-3128247 27 9.4 >04_03_0138 + 11710595-11711271,11711533-11711665,11711819-11711926, 11712307-11712354,11713191-11713250 Length = 341 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -2 Query: 572 PRSKDNNDFIQNYVYTRCSSGPLNNNNLHILEVKLQNH 459 P +++NN F Q + + L NN + E++ Q H Sbjct: 41 PEAEENNQFYQQTMNENLNMNQLGNNGIETAELEPQEH 78 >04_01_0239 - 3126367-3127230,3127342-3128247 Length = 589 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/29 (31%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +1 Query: 541 WIKSLLSFERGYHIMKCYMRHKIY--MWR 621 W++ + RG HI +CY++ K++ +W+ Sbjct: 387 WMEYEYHYLRGIHISECYVKEKLFGCIWK 415 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,766,626 Number of Sequences: 37544 Number of extensions: 210205 Number of successful extensions: 356 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 356 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1549385732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -