BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_H07 (484 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 5.2 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 9.1 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 5.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 200 SLIAATKLKSDLKKKNVVSHVVEVKP*KNDTK 295 S+ A TKL K+ V V KP K TK Sbjct: 225 SIRAVTKLPDTSMAKSFVRKVHATKPPKPQTK 256 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 20.6 bits (41), Expect = 9.1 Identities = 5/19 (26%), Positives = 13/19 (68%) Frame = +3 Query: 78 EHPRRIYERLRVHTMDKKY 134 EH +++ +R+HT ++ + Sbjct: 158 EHSGKLHRHMRIHTGERPH 176 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,592 Number of Sequences: 438 Number of extensions: 2334 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13174803 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -