BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_H05 (569 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal p... 24 4.0 AY341151-1|AAR13715.1| 98|Anopheles gambiae BolA protein. 23 7.0 >X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal protein homologue protein. Length = 269 Score = 23.8 bits (49), Expect = 4.0 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +2 Query: 158 VYKKCYNGTCIVGVNKKV-KGSIAKKAEAYLQAANKPHRHTVAKTKGARMPRLEVVS 325 + K+ T + GV +K+ SIAK E Q H + K K + PR ++ S Sbjct: 174 IIKREITSTDLKGVVEKLLPDSIAKDIEKACQVVYPLHDVYIRKVKVLKKPRFDLSS 230 >AY341151-1|AAR13715.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/49 (20%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +2 Query: 209 VKGSIAKK-AEAYLQAANKPHRHTVAKTKGARMPRLEVVSRVASIPIVE 352 ++ + K+ A +L+ N+ + H V K L V ++ +P+++ Sbjct: 1 IRAGLTKELAPVHLEVVNESYMHNVPKGSETHFKVLVVSTQFEGLPLIK 49 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 642,684 Number of Sequences: 2352 Number of extensions: 14590 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -