BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_H05 (569 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.1 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 21 8.6 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 21 8.6 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 8.6 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.0 bits (47), Expect = 2.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 168 NVITAHALWALTKKSKVRSLRKPKHTFKPL 257 N I A ++L + LRK KH PL Sbjct: 116 NSIHQRASFSLNTDGDIAGLRKKKHKVNPL 145 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 Query: 481 LNSWQGKLNPRGERF 437 L SW + PRGE F Sbjct: 191 LPSWTNNIFPRGELF 205 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 Query: 481 LNSWQGKLNPRGERF 437 L SW + PRGE F Sbjct: 206 LPSWTNNIFPRGELF 220 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 213 KVRSLRKPKHTFKPLTNPTDIQWQRR 290 KV S+ T LT+P W+RR Sbjct: 133 KVCSVNDVNMTITELTDPVKEFWERR 158 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,024 Number of Sequences: 438 Number of extensions: 3815 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -