BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_H03 (694 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 28 0.89 05_07_0106 + 27723877-27723978,27724825-27725100,27726103-27727281 29 4.6 06_01_0469 + 3322886-3323564,3324033-3324953,3325025-3325155,332... 28 8.1 >03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 Length = 380 Score = 28.3 bits (60), Expect(2) = 0.89 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -1 Query: 664 NGISGKIGLNVDGNTERLVVESWLTNLEVVWVTS 563 NG + + G T+R+++ SWL+ LE+ + T+ Sbjct: 224 NGFTEAPETSNSGQTKRVLLSSWLSTLELAYTTA 257 Score = 21.4 bits (43), Expect(2) = 0.89 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 532 VSGIKLAIVKECD*FLNDNIIDFNADEMKFL 440 VSG ++A+ + L+ N++ + DEM L Sbjct: 298 VSGTRIALGDDGSIALSRNVVVLHVDEMLLL 328 >05_07_0106 + 27723877-27723978,27724825-27725100,27726103-27727281 Length = 518 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +3 Query: 138 NRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLS 269 NR+ R L++ +++ E I + CMKK+ ++N L +S Sbjct: 39 NRLLRSLVNIHEQETYSREIITEAIESCMKKQADNLVNTLDVIS 82 >06_01_0469 + 3322886-3323564,3324033-3324953,3325025-3325155, 3325237-3325317,3328173-3328820 Length = 819 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 83 TVLLRSSLRCVDCSCPAFERMG 18 TVLL +S + C C FERMG Sbjct: 388 TVLLDTSTMEISCGCRKFERMG 409 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,838,901 Number of Sequences: 37544 Number of extensions: 332010 Number of successful extensions: 819 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -