BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_H03 (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 31 1.2 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 3.6 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) 28 8.3 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 32.7 bits (71), Expect = 0.29 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +2 Query: 329 ALDFYQTALRDPAFYQLYXRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFD 508 AL + ALR P ++Y + ++ FK LK YP H + + L+ + D Sbjct: 180 ALRYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEYID 239 Query: 509 YSQ 517 Y Q Sbjct: 240 YGQ 242 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.89 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 270 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 362 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 30.7 bits (66), Expect = 1.2 Identities = 25/97 (25%), Positives = 41/97 (42%) Frame = +3 Query: 291 HLNHSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTLTHSSIT*SLILKRNFISSALKS 470 +L HST T S L T T ++++ T + TLTH +IT S I L Sbjct: 26 NLTHSTLTHSNLTHLNLTHSTL-TYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 471 MMLSLRN*SHSLTIANLMPLTVYS*PKKRLRLVTHTT 581 + L+ +HS + + + + +TH+T Sbjct: 85 LTLTYSTLTHSTLTHSTLTHSTLTHSTLTHSTITHST 121 Score = 29.9 bits (64), Expect = 2.0 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = +3 Query: 255 LMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTLTHSSIT*S 428 L L+L ++ HL +ST T S LT T H +++Y T TLTHS++T S Sbjct: 52 LTHLTLTYSTLTHLTITYSTITHSTLTHLTLT--HL----TLTYSTLTHSTLTHSTLTHS 105 Query: 429 LILKRNFISSALKSMMLSLRN*SH 500 + S + L+ N +H Sbjct: 106 TLTHSTLTHSTITHSTLTHSNLTH 129 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 369 SISYXTGLWVTLTHSSIT*SLILKRNFISSALKSMMLSLRN*SHS-LTIANLMPLTV 536 ++++ T + +TLTHS++T + N S L L+ N +HS LT + L LT+ Sbjct: 1 TLTHPTLIHLTLTHSNLTHLTLTHSNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTL 57 Score = 27.9 bits (59), Expect = 8.3 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 4/86 (4%) Frame = +3 Query: 258 MKLSLAMCSVQHLNHSTSTPSCPVRLTFTKP---HFETLH-SISYXTGLWVTLTHSSIT* 425 + L+ + + L H T T S LT T H H ++++ T + TLTHS++T Sbjct: 40 LNLTHSTLTYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTHLTLTYSTLTHSTLTH 99 Query: 426 SLILKRNFISSALKSMMLSLRN*SHS 503 S + S L ++ +HS Sbjct: 100 STLTHSTLTHSTLTHSTITHSTLTHS 125 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 176 PFHRGNQFSCHTIRICLSVGTVRKSFQKCPRTVLL-RSSLRCVDC 45 P H NQ C IC+ G KS KCP L S RC C Sbjct: 245 PCHEANQGGCEGRAICVYTGP-GKSICKCPPGYKLDESQARCTLC 288 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +2 Query: 119 LQKGKFE-----SYGKKIDFHDEKAINFVGNYWQENADL--YEEEVTKDYQ 250 L+KGKF+ S K ID E+ F+G+ W ++ DL +++E K+ Q Sbjct: 1093 LEKGKFQVKQWCSNSKTIDKSCERYCTFLGHKWDKDRDLLTFKKEKIKETQ 1143 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +2 Query: 29 QRPDNYNLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKKIDFHD 169 Q+P+N++LH +A+ T L GKF+S G+ D H+ Sbjct: 4733 QKPNNHHLHRTCKADALEV----NVTLRGGLHAGKFKSVGRTRDVHE 4775 >SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) Length = 474 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 446 LHFVGVKINDVVVEKLVTFFDYSQFDATNSV 538 LH G K++D VVE + F + +QF AT+ V Sbjct: 181 LHAQG-KVDDAVVESVREFLEANQFKATSDV 210 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,215,807 Number of Sequences: 59808 Number of extensions: 408883 Number of successful extensions: 1209 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1069 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1199 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -