BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_G20 (493 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 25 0.49 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 25 0.49 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 25 0.49 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 3.5 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 22 3.5 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 3.5 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 21 4.6 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 21 4.6 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 6.1 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 21 6.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 8.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 8.0 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 8.0 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 8.0 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 8.0 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 8.0 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 8.0 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 8.0 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 8.0 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 24.6 bits (51), Expect = 0.49 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 144 LMSYRNWRTTVCNCPKPFRRSRNSLLRKARKLTSTLSVTTFAFSEQT 284 ++ N T + +CP F + L ++ LT+ S T F+F +T Sbjct: 8 VVEINNGETIIISCPGGFVMEDANNLTQSTILTTCESNTDFSFGSKT 54 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 24.6 bits (51), Expect = 0.49 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +3 Query: 234 KLTSTLSVTTFAFSEQTALPLTTHLTSLLNPMFWLLV 344 KLT T + +AF Q L +T S++ +F + + Sbjct: 270 KLTDTAHMINYAFCVQQLLRITVAFISIVTALFLVAI 306 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 24.6 bits (51), Expect = 0.49 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +3 Query: 234 KLTSTLSVTTFAFSEQTALPLTTHLTSLLNPMFWLLV 344 KLT T + +AF Q L +T S++ +F + + Sbjct: 270 KLTDTAHMINYAFCVQQLLRITVAFISIVTALFLVAI 306 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.8 bits (44), Expect = 3.5 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +3 Query: 216 LLRKARKLTSTLSVTTFAFSEQTALPLTTHLTSLLNPMFWLLVV 347 L R KLTS + AFS Q + + L +L ++L V Sbjct: 233 LCRLHYKLTSVMQKINSAFSVQLLVSIGVSLFDVLFQAYYLYYV 276 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.8 bits (44), Expect = 3.5 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +3 Query: 216 LLRKARKLTSTLSVTTFAFSEQTALPLTTHLTSLLNPMFWLLVV 347 L R KLTS + AFS Q + + L +L ++L V Sbjct: 233 LCRLHYKLTSVMQKINSAFSVQLLVSIGVSLFDVLFQAYYLYYV 276 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.8 bits (44), Expect = 3.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 128 VERTVADVLPELENNCMQLPKAVQALEEQL 217 VERT ++++P L + + AL EQL Sbjct: 46 VERTRSELIPFLTETIYDEDEVLLALAEQL 75 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 21.4 bits (43), Expect = 4.6 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = -3 Query: 116 PPCGSTFESPPPRAMSRSQFCA 51 P C SP P S S F A Sbjct: 194 PTCSEASSSPTPSHSSESSFSA 215 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.4 bits (43), Expect = 4.6 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 208 LERLNGFGQLHTVVLQF 158 +E +NGF +HT+++ F Sbjct: 260 IEAINGFYGVHTLLILF 276 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.0 bits (42), Expect = 6.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 288 LPLTTHLTSLLNPMFWLLVVKLALFNYK 371 LPL LT+ L + + V +L + YK Sbjct: 281 LPLLCILTNTLEILITVTVCELTILEYK 308 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 21.0 bits (42), Expect = 6.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 288 LPLTTHLTSLLNPMFWLLVVKLALFNYK 371 LPL LT+ L + + V +L + YK Sbjct: 106 LPLLCILTNTLEILITVTVCELTILEYK 133 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 192 PFRRSRNSLLRKARKLTSTLSVTT 263 P NS K+ LTS LSV+T Sbjct: 128 PLSTPSNSNATKSSGLTSPLSVST 151 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 192 PFRRSRNSLLRKARKLTSTLSVTT 263 P NS K+ LTS LSV+T Sbjct: 128 PLSTPSNSNATKSSGLTSPLSVST 151 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 192 PFRRSRNSLLRKARKLTSTLSVTT 263 P NS K+ LTS LSV+T Sbjct: 128 PLSTPSNSNATKSSGLTSPLSVST 151 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 192 PFRRSRNSLLRKARKLTSTLSVTT 263 P NS K+ LTS LSV+T Sbjct: 128 PLSTPSNSNATKSSGLTSPLSVST 151 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 192 PFRRSRNSLLRKARKLTSTLSVTT 263 P NS K+ LTS LSV+T Sbjct: 128 PLSTPSNSNATKSSGLTSPLSVST 151 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 192 PFRRSRNSLLRKARKLTSTLSVTT 263 P NS K+ LTS LSV+T Sbjct: 84 PLSTPSNSNATKSSGLTSPLSVST 107 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 192 PFRRSRNSLLRKARKLTSTLSVTT 263 P NS K+ LTS LSV+T Sbjct: 128 PLSTPSNSNATKSSGLTSPLSVST 151 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 192 PFRRSRNSLLRKARKLTSTLSVTT 263 P NS K+ LTS LSV+T Sbjct: 128 PLSTPSNSNATKSSGLTSPLSVST 151 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 192 PFRRSRNSLLRKARKLTSTLSVTT 263 P NS K+ LTS LSV+T Sbjct: 128 PLSTPSNSNATKSSGLTSPLSVST 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,968 Number of Sequences: 336 Number of extensions: 1979 Number of successful extensions: 24 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11525470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -