BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_G19 (419 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6783| Best HMM Match : Porphobil_deamC (HMM E-Value=5.8) 140 4e-34 SB_23832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.89 SB_7305| Best HMM Match : Extensin_2 (HMM E-Value=0.043) 29 2.1 SB_6508| Best HMM Match : AMP-binding (HMM E-Value=2.8026e-45) 29 2.1 SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33) 29 2.1 SB_3165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_41190| Best HMM Match : Extensin_2 (HMM E-Value=0.0029) 29 2.1 SB_14110| Best HMM Match : DUF858 (HMM E-Value=2) 28 3.6 SB_29100| Best HMM Match : TPMT (HMM E-Value=5.4e-33) 27 4.8 SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) 27 6.3 SB_1712| Best HMM Match : Peptidase_C14 (HMM E-Value=1.6e-21) 27 6.3 SB_41291| Best HMM Match : Piwi (HMM E-Value=0) 27 6.3 SB_52816| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_39182| Best HMM Match : Cellulase (HMM E-Value=0.00018) 27 8.3 SB_23673| Best HMM Match : DUF855 (HMM E-Value=0.52) 27 8.3 >SB_6783| Best HMM Match : Porphobil_deamC (HMM E-Value=5.8) Length = 382 Score = 140 bits (339), Expect = 4e-34 Identities = 59/115 (51%), Positives = 84/115 (73%) Frame = +3 Query: 30 IMSADQVFHSRSEGIPSEGVKDQYADGKAARAWNKFIGDSNERTQNYKDFLIGLLKKHGC 209 +MS D V+ +RS G+P+ G+ DQYADGKAA+ W +IG +RT++Y++F LL++ Sbjct: 148 VMSMDGVYRTRSLGVPATGIPDQYADGKAAKVWQHYIGGHKKRTESYREFFCNLLRERNI 207 Query: 210 KKVLDGACGTGIDSMMLVDEGFNLVSVDASDKMLKHALKARWEKRKNPKYDEWVI 374 VLD +CGTG+DS+ML++ GF + SVDASDKMLK AL+ RW +RK +D+W I Sbjct: 208 HNVLDVSCGTGVDSIMLLENGFCVTSVDASDKMLKDALRIRWNRRKEEPFDKWGI 262 >SB_23832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 706 Score = 29.9 bits (64), Expect = 0.89 Identities = 30/112 (26%), Positives = 49/112 (43%) Frame = +3 Query: 63 SEGIPSEGVKDQYADGKAARAWNKFIGDSNERTQNYKDFLIGLLKKHGCKKVLDGACGTG 242 S I EG+ + A R W+ + + +R YK + + +GC VLD G+G Sbjct: 117 SSTIAREGL-ESVASALVER-WHFRMLNDRQRNLAYKKAISNAVS-NGCDIVLDIGSGSG 173 Query: 243 IDSMMLVDEGFNLVSVDASDKMLKHALKARWEKRKNPKYDEWVIEEANWETL 398 I SM V G V + +++K + +++N D+ IE E L Sbjct: 174 ILSMFAVQAGAKKVYACFNVRIVK-VIGGEQLEQENTHLDQEAIEPYTTECL 224 >SB_7305| Best HMM Match : Extensin_2 (HMM E-Value=0.043) Length = 908 Score = 28.7 bits (61), Expect = 2.1 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 9/72 (12%) Frame = -2 Query: 313 FNILSEASTETRLKPSSTSIMESIPVPQAPSSTFL-----HPCFF--KSPMRKSL*FCVL 155 F L +T PS+T + +IP PQ P T L HP F P + SL F + Sbjct: 684 FRTLENLATLRYFGPSNTLLHFAIPHPQIPHYTSLFRTLKHPTTFPYSGPSKTSLHFAIS 743 Query: 154 SLLSP--MNLFH 125 +P +LFH Sbjct: 744 DPRTPYYTSLFH 755 Score = 27.1 bits (57), Expect = 6.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 322 SACFNILSEASTETRLKPSSTSIMESIPVPQAPSSTFL 209 ++ F+ L +T PS+TS+ +IP PQ P T L Sbjct: 856 TSLFHTLEHLTTLRYSTPSNTSLHFAIPDPQTPHYTSL 893 >SB_6508| Best HMM Match : AMP-binding (HMM E-Value=2.8026e-45) Length = 1038 Score = 28.7 bits (61), Expect = 2.1 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 385 LASSITHSSYFGFFLFSHLALSACFNILSEASTETRLKPSST 260 LA S T+ + HLA S+ + L+++ST RL SST Sbjct: 808 LADSSTYEHLADSCTYEHLADSSTYEHLADSSTYARLADSST 849 Score = 26.6 bits (56), Expect = 8.3 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%) Frame = -2 Query: 385 LASSITHSSYFGFFLFSHLALSACFNILSEASTETRLKPSST--SIMESIPVPQ-APSST 215 LA S T++ + HLA ++ + L+++ST L+ SST + +S A SST Sbjct: 835 LADSSTYARLADSSTYEHLADNSTYEHLADSSTYEHLEDSSTYEHLADSSTYEHLADSST 894 Query: 214 FLH 206 + H Sbjct: 895 YEH 897 Score = 26.6 bits (56), Expect = 8.3 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Frame = -2 Query: 391 SQLASSITHSSYFGFFLFSHLALSACFNILSEASTETRLKPSST--SIMESIPVPQ-APS 221 ++LA S T+ + HLA S+ + L ++ST L SST + +S A S Sbjct: 842 ARLADSSTYEHLADNSTYEHLADSSTYEHLEDSSTYEHLADSSTYEHLADSSTYEHLADS 901 Query: 220 STFLH 206 ST+ H Sbjct: 902 STYEH 906 >SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33) Length = 958 Score = 28.7 bits (61), Expect = 2.1 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 9/72 (12%) Frame = -2 Query: 313 FNILSEASTETRLKPSSTSIMESIPVPQAPSSTFL-----HPCFF--KSPMRKSL*FCVL 155 F L +T PS+T + +IP PQ P T L HP F P + SL F + Sbjct: 633 FRTLENLATLRYFGPSNTLLHFAIPHPQIPHYTSLFRTLKHPTTFPYSGPSKTSLHFAIS 692 Query: 154 SLLSP--MNLFH 125 +P +LFH Sbjct: 693 DPRTPYYTSLFH 704 >SB_3165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1183 Score = 28.7 bits (61), Expect = 2.1 Identities = 21/82 (25%), Positives = 36/82 (43%) Frame = -2 Query: 397 NVSQLASSITHSSYFGFFLFSHLALSACFNILSEASTETRLKPSSTSIMESIPVPQAPSS 218 +++ AS + +S+ F F+ F I AST + P+S + S+ P +P+S Sbjct: 655 SLTSFASFTSFTSFTSFASFTSFTSFTSFAIALLASTASPASPASLASPASLASPASPAS 714 Query: 217 TFLHPCFFKSPMRKSL*FCVLS 152 P SP + F + S Sbjct: 715 -LASPASLASPASTTTAFYLAS 735 >SB_41190| Best HMM Match : Extensin_2 (HMM E-Value=0.0029) Length = 476 Score = 28.7 bits (61), Expect = 2.1 Identities = 19/87 (21%), Positives = 40/87 (45%) Frame = -1 Query: 374 DYPFIIFWVFPLLPPGFERVLQHFVRSVN*NKIETFVYQHHGVNPCSASTVQHFLASVFF 195 D P ++ + +PP R ++ V N I F+Y +HGV ++ + HF+ + + Sbjct: 292 DIPHFMY-TYHGVPPNDIRHFRYTYHGVPSNDIPHFMYTYHGV---PSNDIPHFMCT-YH 346 Query: 194 QKPDEEVFIILCSFITVSNEFVPRSSC 114 P ++ + ++ V + +P C Sbjct: 347 GVPSNDIPHFMYTYHGVPSNDIPHFMC 373 >SB_14110| Best HMM Match : DUF858 (HMM E-Value=2) Length = 207 Score = 27.9 bits (59), Expect = 3.6 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +3 Query: 213 KVLDGACGTGIDSMMLVDEGF-NLVSVDASDKMLKHALKARWEKRKNPKYDE 365 ++LD GTG+ + LV GF N+ ++D S+K + A K K Y E Sbjct: 69 RILDVGSGTGLQAEGLVKHGFTNIDALDPSEKSHEVARKKNLYKNYITDYLE 120 >SB_29100| Best HMM Match : TPMT (HMM E-Value=5.4e-33) Length = 242 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 213 KVLDGACGTGIDSMMLVDEGFNLVSVDASDKMLK 314 +VL CG +D + L D+G +V V+ + K ++ Sbjct: 55 RVLLPLCGKSLDLLWLADQGCQVVGVEGASKPIE 88 >SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) Length = 629 Score = 27.1 bits (57), Expect = 6.3 Identities = 18/87 (20%), Positives = 36/87 (41%), Gaps = 3/87 (3%) Frame = -1 Query: 353 WVFPLLPPGFERVLQHFVRSVN*NKIETFVYQHHG---VNPCSASTVQHFLASVFFQKPD 183 W+FP + + F + I+ + + + T H + S Q+ Sbjct: 67 WLFPYIEHAIIQHNMEFAEYIKSPSIDNVLLKRRNTPYIEGTLCVTGHHLIFSSRTQR-S 125 Query: 182 EEVFIILCSFITVSNEFVPRSSCLTVC 102 EE+F+++ V +FV + + LT+C Sbjct: 126 EELFLLISGVEHVEKKFVGQEAILTIC 152 >SB_1712| Best HMM Match : Peptidase_C14 (HMM E-Value=1.6e-21) Length = 594 Score = 27.1 bits (57), Expect = 6.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 233 ASTVQHFLASVFFQKPDEEVFIILCSFI 150 A++V H S+ +KPDE + ++ CS + Sbjct: 473 ATSVIHLTDSIHPRKPDEMLIVLTCSLV 500 >SB_41291| Best HMM Match : Piwi (HMM E-Value=0) Length = 598 Score = 27.1 bits (57), Expect = 6.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 338 LPPGFERVLQHFVRSVN 288 LPP FE+ +HFVR N Sbjct: 516 LPPAFEQTTRHFVRGEN 532 >SB_52816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1622 Score = 26.6 bits (56), Expect = 8.3 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +3 Query: 210 KKVLDGACGTGIDSMMLVDEG--FNLVSVDASD 302 K VLD CGTGI S+ EG + +V+AS+ Sbjct: 153 KVVLDVGCGTGILSLFCAREGKASKVYAVEASE 185 >SB_39182| Best HMM Match : Cellulase (HMM E-Value=0.00018) Length = 949 Score = 26.6 bits (56), Expect = 8.3 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 385 LASSITHSSY-FGFFLFSHLALSACFNILSEASTETRLK 272 +AS++ + SY GF LF+ L L C N S + E K Sbjct: 133 VASTLKNKSYTLGFNLFTELGLDGCGNNCSGSLRENTTK 171 Score = 26.6 bits (56), Expect = 8.3 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 385 LASSITHSSY-FGFFLFSHLALSACFNILSEASTETRLK 272 +AS++ + SY GF LF+ L L C N S + E K Sbjct: 474 VASTLKNKSYTLGFNLFTELGLDGCGNNCSGSLRENTTK 512 Score = 26.6 bits (56), Expect = 8.3 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 385 LASSITHSSY-FGFFLFSHLALSACFNILSEASTETRLK 272 +AS++ + SY GF LF+ L L C N S + E K Sbjct: 780 VASTLKNKSYTLGFNLFTELGLDGCGNNCSGSLRENTTK 818 >SB_23673| Best HMM Match : DUF855 (HMM E-Value=0.52) Length = 380 Score = 26.6 bits (56), Expect = 8.3 Identities = 25/90 (27%), Positives = 37/90 (41%), Gaps = 6/90 (6%) Frame = +3 Query: 78 SEGVKDQYADGKAARAWNKFIGDS-----NERTQNYKDFLIGLLKKHGCKKVLDGACGTG 242 S G KD+ G + + DS RT Y++ + K VLD CGTG Sbjct: 137 SNGAKDKPKPGASEMTSADYYFDSYAHFDEVRTLTYRNSMYHNKHLFRDKIVLDVGCGTG 196 Query: 243 IDSMMLVDEGFNLVSVDASDKMLK-HALKA 329 I SM G V + +++ H L++ Sbjct: 197 ILSMFAAKAGAKHVYAITNTNLIQTHMLES 226 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,244,128 Number of Sequences: 59808 Number of extensions: 263733 Number of successful extensions: 943 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 936 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -