BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_G19 (419 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 3.2 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 21 4.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 4.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 4.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 4.3 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 21 5.6 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.5 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 20 9.9 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 20 9.9 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 20 9.9 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 341 LLPPGFERVLQHFVRSV 291 +LP GF +VL H V+ + Sbjct: 68 MLPTGFRKVLVHNVKEL 84 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -2 Query: 325 LSACFNILSEASTETRLKPSSTSIMESIPVPQAPSSTFLH 206 L C + + E R + I +IPVPQA + ++ Sbjct: 29 LGNCVRVSPVITIEPRRRKFHKPITLTIPVPQAANKGMIN 68 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 4.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 240 GIDSMMLVDEGFNLVSVDASDKMLK 314 G+DS EGF +VD ++L+ Sbjct: 388 GLDSQFCTVEGFITAAVDEWPRLLR 412 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 4.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 240 GIDSMMLVDEGFNLVSVDASDKMLK 314 G+DS EGF +VD ++L+ Sbjct: 441 GLDSQFCTVEGFITAAVDEWPRLLR 465 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 4.3 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 244 IPVPQAPSSTFLHP 203 +PVPQ ST L P Sbjct: 796 VPVPQVNDSTILSP 809 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.0 bits (42), Expect = 5.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 251 GVNPCSASTVQHFL 210 GV+ C A+ V HFL Sbjct: 25 GVDECQATPVIHFL 38 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 20.6 bits (41), Expect = 7.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 313 FNILSEASTETRLKPSSTSIMESIPVPQAPSSTF 212 FN + A T T PS S P P +PSS F Sbjct: 69 FNDSAAAITST--SPSYPGGGSSSPSPSSPSSFF 100 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 154 KEHKIIKTSSSGF*KNTDARK 216 KEHKII + S+ + N + K Sbjct: 77 KEHKIISSLSNNYNYNNNNYK 97 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 154 KEHKIIKTSSSGF*KNTDARK 216 KEHKII + S+ + N + K Sbjct: 77 KEHKIISSLSNNYNYNNNNYK 97 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 154 KEHKIIKTSSSGF*KNTDARK 216 KEHKII + S+ + N + K Sbjct: 77 KEHKIISSLSNNYNYNNNNYK 97 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,116 Number of Sequences: 438 Number of extensions: 2270 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10750329 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -