BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_G18 (512 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 30 0.040 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 27 0.37 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 27 0.37 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 26 0.65 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 25 1.5 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 24 2.6 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 24 2.6 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 2.6 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 24 2.6 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 2.6 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 24 3.5 EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle... 23 6.1 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 23 6.1 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 6.1 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 6.1 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 6.1 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 8.0 AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-tran... 23 8.0 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 8.0 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 8.0 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 30.3 bits (65), Expect = 0.040 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 141 SGS-RRHELSQPPGIVSRPGSPPCRSRGAPTRRCPRGEAPPTSAAP 7 SGS R+ QP GI RPG P G P R P PP P Sbjct: 61 SGSVERNPAIQPVGIFGRPGRPWWSVPGIPPFRPPWHPRPPFGGRP 106 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 27.1 bits (57), Expect = 0.37 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = -3 Query: 459 SRCTPAFPCKSRSTRSARGG----TAPRGTAPSGRGRGSAVGTPRSPMTRS 319 S C+P S S S+ G T+P + +G S+VG P +P S Sbjct: 236 SSCSPLSTASSASCSSSAAGSLCPTSPPASVSNGEQPASSVGDPANPQQPS 286 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 27.1 bits (57), Expect = 0.37 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 178 RLISLSGASRDSFRISETRALSASWNRLSSRLSAMP 71 RL++ GASR R+ E + W R +A P Sbjct: 859 RLLAAPGASRKDIRLEERQGTFQEWQRAWDAAAAAP 894 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 26.2 bits (55), Expect = 0.65 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -3 Query: 507 C*TASRACAAGSLTFRSRCTPAFPCKSRST 418 C T C+ LTF +C P P S T Sbjct: 101 CLTHMECCSGNCLTFSYKCVPLSPSDSAMT 130 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +3 Query: 303 CTNFNETWSSDCEVYRQRCL 362 CT SS+C YR +C+ Sbjct: 315 CTRHENCCSSNCHSYRGKCV 334 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 25.0 bits (52), Expect = 1.5 Identities = 11/39 (28%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = -3 Query: 162 QEHRVTHSGSRRHELSQPPGIVSRPGSP----PCRSRGA 58 Q+H++ H+G R + I P +P PC+ G+ Sbjct: 159 QQHQLEHNGGREQMMKNETSIDEVPNAPAPKAPCQPAGS 197 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 24.2 bits (50), Expect = 2.6 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -3 Query: 126 HELSQPPGIVSRPGSPPCRSRGAPTRRCPRGEAPPTSAAP 7 +E SQP ++R +P ++ PT E PTS P Sbjct: 378 NEESQPDTFINRVQAPTTPAKWRPTVNIADYENRPTSTRP 417 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 24.2 bits (50), Expect = 2.6 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 Query: 408 RGGTAPRGTAPSGRGRGSAVG 346 RGG PRGT + G G G Sbjct: 258 RGGNYPRGTERNRNGNGYGAG 278 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.2 bits (50), Expect = 2.6 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -3 Query: 432 KSRSTRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRSR 316 +SRS + G+ R + SG GS G+ +RSR Sbjct: 1064 RSRSRSRSGSGSRSRSRSGSGSRAGSRAGSGSRSRSRSR 1102 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 24.2 bits (50), Expect = 2.6 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 438 PCKSRSTRSARGGTAPRGTAPSGRGRGSAVGTPRS 334 P +S A GG P + +GR +A G P S Sbjct: 67 PGRSHPAEPAPGGNGPFVRPDAPQGRSAAEGVPSS 101 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 72 RSRGAPTRRCPRGEAPPTS 16 + GA R+CP+G+ P S Sbjct: 271 KDNGACVRKCPKGKMPQNS 289 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 23.8 bits (49), Expect = 3.5 Identities = 6/22 (27%), Positives = 13/22 (59%) Frame = +3 Query: 222 CEINEHGEAICNCIKECPYETD 287 C +H + +C+ +++CP D Sbjct: 26 CRTPDHRDGVCHPVQQCPSVRD 47 >EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle protein protein. Length = 178 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -2 Query: 349 RYTSQSDDQVSLKFVHTLRLESVSYGHSLMQLQIASPCSLISQTRPAL 206 +Y+ D S VH+ RL + Y ++ ++ A+P PA+ Sbjct: 54 QYSKAVDSAHSSVRVHSSRLSNDGYAYAAPAVKYAAPAYAAHYAAPAV 101 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 469 DISFSLHSGISLQVP*YSI 413 D S +LH G+ + +P Y+I Sbjct: 396 DTSVTLHPGMKIMIPAYAI 414 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 4/24 (16%) Frame = +2 Query: 50 RVGAP----RERHGGEPGRETIPG 109 R GAP R+ GEPGR +PG Sbjct: 542 RPGAPGLPGRDGEKGEPGRPGLPG 565 Score = 22.6 bits (46), Expect = 8.0 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 80 GEPGRETIPG 109 GEPGR+ IPG Sbjct: 383 GEPGRDGIPG 392 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.0 bits (47), Expect = 6.1 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -3 Query: 144 HSGSRRHELSQPPGIVSRPGSPPCRSRGAPTRRCPRGEAPPTSAA 10 H G + PP R PP APT++ P AP +++ Sbjct: 907 HRGPGAAAATGPPPPTHRLEQPPQVVAAAPTQQQPLPPAPAAASS 951 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/41 (24%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 219 VCEINEHGEAICNCIK--ECPYETDSRRKVCTNFNETWSSD 335 +C N H A+C+C + C E + +WS++ Sbjct: 769 LCSYNTHCFALCHCCEFDACDCEMTCPNNCACYHDNSWSTN 809 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 22.6 bits (46), Expect = 8.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -2 Query: 244 SPCSLISQTRPALQCTFMHGSSRLISLSGASRDSFR 137 S C+ + + ++ C + GS +G SRDS R Sbjct: 38 STCNAPTDSANSVSCAGVCGSKHHTHCTGLSRDSTR 73 >AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-transferase u3 protein. Length = 218 Score = 22.6 bits (46), Expect = 8.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 420 YYGTCREMPECSENE 464 +Y CRE+P ENE Sbjct: 186 WYERCRELPGFDENE 200 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 22.6 bits (46), Expect = 8.0 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +2 Query: 2 DYGAADVGGASPRGHLRVGAPR-ERHG-GEPGRETIPG 109 D G + VG P+G+ + P+ ER G G+ G +PG Sbjct: 97 DPGLSMVGPPGPKGNPGLRGPKGERGGMGDRGDPGLPG 134 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 22.6 bits (46), Expect = 8.0 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 53 LGDVPAGKPRRRR 15 LGDVP G+ RR R Sbjct: 1146 LGDVPQGRQRRGR 1158 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 573,459 Number of Sequences: 2352 Number of extensions: 12628 Number of successful extensions: 59 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -